SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000018593 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000018593
Domain Number 1 Region: 2-318
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 5.02e-72
Family L-arabinose binding protein-like 0.0025
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000018593
Domain Number - Region: 329-386,449-465
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0377
Family Growth factor receptor domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000018593   Gene: ENSCPOG00000020200   Transcript: ENSCPOT00000024696
Sequence length 667
Comment pep:novel scaffold:cavPor3:scaffold_42:15358324:15377835:-1 gene:ENSCPOG00000020200 transcript:ENSCPOT00000024696 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VAQKDTFLAFAMVSLMLHFHWTWVGVLTTEGHKGLQFLSDVRTEMDRNRVCVAFVKIVSS
ITVSYFSAMQKHDILTADTSSVNVVVIYYDTDSLNDVSYNIVQNLMTWKVWMTNSQWQPV
LDGRNFILDSFHGVLVFSHHFQEISGFKNYVQEATPFKYPEDTYLFLYWYKNFHCSFSES
DCALENCIPNASLAWLPPNHFDTAMNDRSYNIYNGVYAVAHALHAMLFAEEQRPSMRNRQ
MKMFSPWQLNPFLKNTQFSNSAGDQVNLNDRRKLDSEYDILNFWNFPEGLRLKVKVGTFS
SHAPHGQKMTLSEDMIEWSTGVTEIPLSVCSQSCSPGFRKSPQEGKAACCFDCTPCANSE
ITNETDMEQCVKCLGHQYANTQRNQCLHKIVTFLAYEDPLGKALAGTALSLTALTAAVLG
LFVKHQDTAIVKANNRTLSYILLISLLSCFLCSLLFIGQPNTATCILQQTTFGLAFTVAV
STVLAKTITVVLAFKITAPGKRMRRLLVSGKPNFIIPICSLIQLTLCGFWMGTNPPYIDT
DAHAEHGHIIIVCNKGSLTAFYCVLGYLGSLALLSFTVAFLARNLPDTFNEAKFLTFSML
VFCSVWVTFLPVYHSSKGKVMVAMEVFSILASAAGLLGCIFVPKCYIILLRPERNSLTGI
KNNILSV
Download sequence
Identical sequences 10141.ENSCPOP00000018593 ENSCPOP00000018593 ENSCPOP00000018593

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]