SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000018915 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000018915
Domain Number 1 Region: 122-269
Classification Level Classification E-value
Superfamily C-type lectin-like 7.7e-45
Family C-type lectin domain 0.00000909
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000018915   Gene: ENSCPOG00000024659   Transcript: ENSCPOT00000026696
Sequence length 273
Comment pep:novel scaffold:cavPor3:scaffold_44:12225855:12228296:-1 gene:ENSCPOG00000024659 transcript:ENSCPOT00000026696 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KDTFRGQRFTQKDPEVSTHRPVSFPGTMCMACGWGCRGSCPAWQRGPRSVPKPHFCLSPG
PAVLRARWLLLLLLILSLAICFMLLVTTLVQVSRIPKFPQVEAQDHEENLRLAAASQGPV
HSSLQQIHQQLSQINASLARLCRPCPWNWEPFQGSCYLFSRTLGSWDSSVSSCQAMGAHL
VIINSVAEQRFLSYWDIRKNYLTWIGLSDQNKEGSWNWVDNTPLQLSFWKDGEPHNNGNE
GCVQLAENTWSDNRCTAQNFWICEKPLTPCPGL
Download sequence
Identical sequences 10141.ENSCPOP00000018915 ENSCPOP00000018915 ENSCPOP00000018915

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]