SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000019055 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000019055
Domain Number 1 Region: 248-384
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000157
Family Growth factor receptor domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000019055   Gene: ENSCPOG00000027465   Transcript: ENSCPOT00000025386
Sequence length 850
Comment pep:known scaffold:cavPor3:scaffold_4:18236865:18248320:1 gene:ENSCPOG00000027465 transcript:ENSCPOT00000025386 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PGSGSRCGISCPARRHSCRPPPRPRTPLPAALLLLLLWLLPGPAAPQELNPRGRNVCRAP
GSQAPTCCAGWKQQGDECGIAVCEGNSTCSENEVCVRPGECRCRHGYFGANCDTKCPRQF
WGPDCKERCICHPHGQCEDVTGQCTCHAQRWGERCEHACQCQHGTCHPRSGACRCEPGWW
GAQCARACYCSATSRCDPQTGACQCHAGWWGRSCNNQCACNSSPCEQQSGRCQCRERTFG
ARCERYCQCFRGRCHPVDGTCACEPGYRGKYCREPCPAGFYGLGCRRRCGQCKGQQPCTV
AEGRCLTCEPGWNGTKCDQPCAAGFYGEGCGHRCPPCRDGHACNHVTGKCTRCNAGWIGD
RCETKCSNGTYGEDCAFVCADCASGHCDFQSGRCLCSPGVHGPHCNMTCPMGHHGVDCAQ
TCSCHEDSCDPVTGACHLETNQRKGVMGAGALLALLLSLLGCCCACRGKDPIRRELSLGR
KKAPHRLCGRFSRISMKLPRIPLRRQKLPKVVVAHHDLDNTLNCSFLEPPSGLDQPSPSW
SSRASFSSFDTTDEGPVYCVPHEEAAAETRDPEAPSAPAEAPVPSPALLTTLASAEEAPP
LSASSDSERSASSVEGPGGALYARVGLSLSPSPERRKPPPPDPATKPKVSWIHGKHGAAA
ATQAPSPSPPGPEPAPSPSKRKRTPSDTSARPEEPSSPRPRDTTLRPPGLAEEVLAPVAP
SPPRARARGRGPGLSEPTDACGPPRSAPEAASMLAAELRDKTRSLGRAEAASGAQGPREK
PAPPQKAKRSVPPASPARVSPAPEVTGLEKAATSTPAPETPRKKTPIQKPPRKKSREAAG
EPPRVGAPTL
Download sequence
Identical sequences ENSCPOP00000019055 ENSCPOP00000019055 10141.ENSCPOP00000019055

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]