SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000019082 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000019082
Domain Number 1 Region: 194-271
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000074
Family Growth factor receptor domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000019082   Gene: ENSCPOG00000020273   Transcript: ENSCPOT00000024562
Sequence length 561
Comment pep:known scaffold:cavPor3:scaffold_12:31146860:31272198:1 gene:ENSCPOG00000020273 transcript:ENSCPOT00000024562 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVTETRTGPLGCSNYDNLDSVSSVLVQSPENKIQLQGLQVLLPDYLQERFVQAALSYIAC
NSEGEFICKDNDCWCQCGPRFPECNCPSMDIQAMEENLLRITETWKAYNSDFEESDEFKF
FMKRLPMNYFLNTSTIMHLWTMDSNFQRRYEQLENSMKQLFLKAQKIVHKLFSLSKRCHK
QPLIILPRQRTSTYWLNRIQSFLYCNENGLLGSFSEETHSCTCPNDQVVCTAFLPCTVGD
ASACLTCAPDNRTRCGTCNTGYMLSQGLCKPEVAESTDHYIGFETDLQDLEMKYLLQKAD
RRIEVHAIFISNDMRLNSWFDPSWRKRMLLTLKSNKYKSSLVHMILGISLQICLTKNSTL
EPVLAIYVNPFGGSHSESWFMPVNENSFPDWERTKLDLPLQCYNWTLTLGNKWKTFFETV
HIYLRSRIKSSGPNGNESIYYEPLEFIDPSRNLGYMKINNIQVFGYSMHFDPEAIRDLIL
QLDYPYTQGSQDSALLQLLEIRDRVNKLSPPGQRRLDLFSCLLRHRLKLSTSEVVRILSA
LQAFNAKLPNTMDYDTTKLCS
Download sequence
Identical sequences ENSCPOP00000019082 ENSCPOP00000019082 10141.ENSCPOP00000019082

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]