SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000019161 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000019161
Domain Number 1 Region: 22-97
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000569
Family V set domains (antibody variable domain-like) 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000019161   Gene: ENSCPOG00000020055   Transcript: ENSCPOT00000019460
Sequence length 99
Comment pep:novel scaffold:cavPor3:scaffold_13:18666702:18667128:-1 gene:ENSCPOG00000020055 transcript:ENSCPOT00000019460 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSVTVFLLGIPFTLSKRKRSPSVAQPDRHVTVSEGHPLLLKCNYTYGAPPYLFWYIQQP
GQGLQLVLKYLTGASQIKGVRGFEAEFKKNESSFHLEKA
Download sequence
Identical sequences 10141.ENSCPOP00000019161 ENSCPOP00000019161 ENSCPOP00000019161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]