SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000019186 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000019186
Domain Number 1 Region: 5-318
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.65e-70
Family L-arabinose binding protein-like 0.0036
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000019186
Domain Number - Region: 328-388,435-465
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000732
Family Growth factor receptor domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000019186   Gene: ENSCPOG00000022619   Transcript: ENSCPOT00000023708
Sequence length 667
Comment pep:novel scaffold:cavPor3:scaffold_95:1535220:1553275:-1 gene:ENSCPOG00000022619 transcript:ENSCPOT00000023708 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASEETALAQGMVSLMLHFSWIWVGVAITEGPKGLHFLADVTKEMDRNRVCMAFVKMIPV
DPLSYMAHTQQHEFLVGESSAVNVVIIYYDADSLNDINYSIGLHLVTWRVWVTNSQWHAD
LTGKKFLLDSFHGTIIFSNHHEEISGFKHFVQTVNLSMYPEDIFLYQFWYWNFNCLISES
DCSLKNCTPNASLAQLPANRFDPAMSDVSYNIYNAVYTVAHALHEMTLQQVQMQNTGSGE
RRTFSPWQLHPFLRSIQFTNPAGHHVSLDKKIKLDIKYDILNLWNFPEGLRLKVKVGEFS
PYAIHGQQLSLFQEMIQWATGHTETPHSVCSDSCNPGFRKSPQEGKAACCFDCTPCPENE
ITNDTDMKNCMKCPDHQYASIQRNQCLPKAVTFLAYEDSMGMTLAGTALSLTSLTAAVLV
LFVKHQDTPIVKANNRALSYTLLISLMFCFLCSLLFIGCPNTISCILQQTTFGVVFTVSV
STVLAKTVTVMLAFKFTVPGSRMRQLLVSGAPNYIIPTCTLIQLTICGVWMGTSPPFVDT
NAHSEHGHIIIVCNKGSLTAFYFILGYLGSLSLISFIVAFMARNLPDAFNEAKFLTFSML
VFCSVWVTFLPVYHSSKGKVMVTMEVFCILASSSGLLGCIFFPKCYIILLKPERNSLHEF
RNQRYSG
Download sequence
Identical sequences ENSCPOP00000019186 10141.ENSCPOP00000019186 ENSCPOP00000019186

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]