SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000019217 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000019217
Domain Number 1 Region: 25-159
Classification Level Classification E-value
Superfamily C-type lectin-like 1.52e-25
Family C-type lectin domain 0.0025
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000019217
Domain Number - Region: 266-339
Classification Level Classification E-value
Superfamily PKD domain 0.000235
Family PKD domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000019217   Gene: ENSCPOG00000003083   Transcript: ENSCPOT00000003126
Sequence length 969
Comment pep:novel scaffold:cavPor3:scaffold_159:1231:29693:-1 gene:ENSCPOG00000003083 transcript:ENSCPOT00000003126 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHAAGLVLLGLAWRLPAVTSKPEDDGFCSKTQVAFRDACYEFVPLGRTFRGAQSWCEAQG
GHLVFVRDESTQRFLQQHLPQDREWWIGLTGTPARNGTTGGPGTWLDLSNVSFSNWQPGR
VAPAAQTCGHIRRGPSGTWAAVDDCAQAFAFVCETEAGQSLACEGRNATMHCGSGEVIQV
QDAVYGRQTPHYCTQDAWQPSDPQEDCSWVSVRDEVAGQCQGLQACQVAADGTYFGDLCP
SRGSYLWVRYQCREGLRLLVPNESFVFDNVTISLMWLLSPFVGNLSCILSMGDGHTLDPY
YPPSLFSTVSHQFTSAGDFTVFAECTTSEWHVTAQKLVTLRDTMEQLSVTGCPGLSRSGA
GVLCRAVLGDPLWIQVELGAGTGVIYTVLLGNTTLAESTAQQGSLPYNLTLDRDIQDLLG
PGKHLLEILARSDSPTSVPSGNLTLQLQLVELLSGLQASWVSTRVGLGQDLMINVSVAHG
TLEGLTFEVTGLSANFSQEEESFGEPSGTYRVIVPVEGTFLVTVRVRNTFSSLSLQMGSV
TVTSKESRALGATQQPLPLQGDGGSTELYVEPGLYVDPFTTLTLGWPEAHRDLGFRWSCG
RCWAQWGRCVQRRLLRTDQRELVVPPSCLPPPDSAVTLRLAVLRGRELQSEVERCLYVSA
LLDLRPRVSCEQNCRPVNSDDDVLLRVTLQGDALEALFSWYLDSPSAEQAEPLPDACRLP
GFWPRSPALLQSDTSTLRLVSSSLRSWGPVIRVRATALTEHAYGEDTYVISTLPPPVVPA
CTIVPEQGTVLTSFAILCNASVSLGPLEFCFCLESGSCLHCGPEPALPSVYLPLGKEIDD
FVVTVVVSVTNQAGDKQQTQATVKVGLGDTRVKDVAFQAVVQEKITATLQGPDGPERLLQ
LAKSVSSVLTLAQGSGPLLSSSACAKVREHVLGSLSEVTTGLRDMQRVQQLAEVLKDLTQ
HRELVPTAQ
Download sequence
Identical sequences ENSCPOP00000019217 10141.ENSCPOP00000019217 ENSCPOP00000019217

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]