SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000019239 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000019239
Domain Number 1 Region: 200-280
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 5.76e-25
Family Thyroglobulin type-1 domain 0.00023
Further Details:      
 
Domain Number 2 Region: 30-113
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.49e-22
Family Growth factor receptor domain 0.0000476
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000019239   Gene: ENSCPOG00000025683   Transcript: ENSCPOT00000024490
Sequence length 286
Comment pep:known scaffold:cavPor3:scaffold_66:1841054:1846297:1 gene:ENSCPOG00000025683 transcript:ENSCPOT00000024490 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHRARPALWATALITLALRAGVSAVGAGPVVRCEPCDARALAQCAPPPTAPACAELVREP
GCGCCLTCALREGQACGVYTERCGSGLRCQPQPDEPRPLHALLHGRGFCANASAAGRLHS
FLLPASSAPGNASESEEDQSTSSVETQAVPGTHRVTDSKSHTLHTKMDVIKKGHAKDSQR
YKVDYESQSTDTQNFSSESKRETEYGPCRREMEDTLNHLKFLNVLSPRGVHIPNCDKKGF
YKKKQCRPSKGRKRGFCWCVDKYGQPLPGYDAKGKEDVHCLSMHSQ
Download sequence
Identical sequences ENSCPOP00000019239 10141.ENSCPOP00000019239 ENSCPOP00000019239

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]