SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000019462 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000019462
Domain Number 1 Region: 51-119
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000628
Family Growth factor receptor domain 0.0048
Further Details:      
 
Domain Number 2 Region: 115-185
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000034
Family Fibronectin type I module 0.067
Further Details:      
 
Domain Number 3 Region: 214-259
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000562
Family TSP-1 type 1 repeat 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000019462   Gene: ENSCPOG00000022434   Transcript: ENSCPOT00000026322
Sequence length 367
Comment pep:known scaffold:cavPor3:scaffold_51:3414665:3440057:-1 gene:ENSCPOG00000022434 transcript:ENSCPOT00000026322 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQCFLSWALAAVTAAAAGSILATTLSPAPATMGVTPAPVEDTASHLEFCKWPCECPPSPP
RCPLGVSLITDGCECCKICAQQLGDNCTEAAICDPHRGLYCDYSRDRPRYAIGVCAQVVG
VGCVLNGVRYSNGESFQPSCRYNCTCIGGAVGCTPLCLRARPPRLWCHQPRRVRVPGQCC
EQWVCEDDDWRPRQTVLGDTTALAAISDMEPWHGNCLPYTSPWSPCSTSCGLGISTRISN
ANAQCWPEQESRLCNLRPCDVDIRLHIKEGKKCLAVFQPEVPINFTLAGCVSTHSYRPKY
CGICVDNRCCIPYKSRTIDVSFQCPEGPGFSRKVLWINACFCNLTCRNPNDIFADLEPYP
DISEIAN
Download sequence
Identical sequences A0A286XDW1
ENSCPOP00000019462 XP_013005382.1.53824 10141.ENSCPOP00000019462 ENSCPOP00000019462

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]