SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000019465 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000019465
Domain Number 1 Region: 2-437
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 7.06e-104
Family L-arabinose binding protein-like 0.0001
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000019465
Domain Number - Region: 441-508
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00667
Family Growth factor receptor domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000019465   Gene: ENSCPOG00000023880   Transcript: ENSCPOT00000026009
Sequence length 785
Comment pep:known scaffold:cavPor3:scaffold_42:13947450:13956144:1 gene:ENSCPOG00000023880 transcript:ENSCPOT00000026009 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KNYQYVLAFYFAIEEINKGSQLLPNVTLGFQVYNAIASDHFALWSTLHWLCGTDIPLPNY
NCQTHRKFAAVIAGTSAAFSAETGTILELYKFPQFFQVTYGPFDPILSDKHQYPSVYQMA
PTDSTLVHAVISLLLHFGWTWVAIFVSNDVKGEHFLGDLKAEMLKKGICVALTKKLPATK
IMYASSDITLMSKIRVSSANVHILYGEVASLINVDIAAEFFLTTGKVWIMTAKWDIVVYE
TDHMLHSFHGSFSFSPHKGEVPGFRHFLQTTKPSQYPEDFYFSKLWLNFFDCSLPGSQCG
RIGVCPPNTSLEFMPGNIDLMTLSDSSYFIYNAVYALAHVLHKMLLEKAEHHAISQTQIC
LSFNLKLHPHLKKMEFTNSAGFSIFLDEERQHVAQYDIQNTLNFPGGLRMLVKVGEFFFK
RPQGQSLVVNEDLIEWPVGFTETPPQSVCSHSCGPGFSKIPQEGRPVCCFTCIFCPERHI
SNQTDAEQCIHCPKHEYPNRNRDRCLPKILDFLSFEDSLGMALTHVALSFSVLTVVIMAI
FVKHRDTAIVKANNRTLSYTLLISLLLCFLCSLLFIGRPNTATCILQQMTFGLVFTVAVS
SVLAKTITVVLAFKVTGPGRRMRHLLVSGAPNYIIPICTLIQLTICGFWMGTNPPYIDTD
AYSEHGHIILLCNKGSLTAFYCVLGFLGSLALLSFTVAFLAKNLPDTFNEAKFLTFSMLV
FCSVWVTFLPVYHSSKGKVMVAMEVFSILASSAGLLGCIFLPKCYVIFIRSENNTLTGLK
TRCYF
Download sequence
Identical sequences ENSCPOP00000019465 ENSCPOP00000019465 10141.ENSCPOP00000019465

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]