SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000019567 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000019567
Domain Number 1 Region: 2470-2628
Classification Level Classification E-value
Superfamily C-type lectin-like 2.62e-41
Family C-type lectin domain 0.00000564
Further Details:      
 
Domain Number 2 Region: 148-249
Classification Level Classification E-value
Superfamily C-type lectin-like 7.04e-41
Family Link domain 0.0025
Further Details:      
 
Domain Number 3 Region: 251-360
Classification Level Classification E-value
Superfamily C-type lectin-like 9.29e-31
Family Link domain 0.0032
Further Details:      
 
Domain Number 4 Region: 2426-2467
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000084
Family EGF-type module 0.0087
Further Details:      
 
Domain Number 5 Region: 2629-2687
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000987
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 6 Region: 35-148
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000524
Family V set domains (antibody variable domain-like) 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000019567   Gene: ENSCPOG00000025484   Transcript: ENSCPOT00000023231
Sequence length 2731
Comment pep:novel scaffold:cavPor3:scaffold_1:20562239:20653025:-1 gene:ENSCPOG00000025484 transcript:ENSCPOT00000023231 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLVPIRSIMWICSTFVVTQALPAGPMGNGATVQGWLAGTVVLPCRLPELSTSRLAAQAGG
ESLRVKWSKIEVDRSGRDLRETTVLVAQDGHVKVGPDFQGRVSVPLQPATAGDASLILGA
LRASDAGRYRCDLLLGVEDAQATVALAVDGVVFHYRAATSRYTLNFEAAQKACVDIGAVI
ATPEQLFAAYEDGFEQCDAGWLSDQTVRYPIRVPREGCFGDMMGKEGVRTYGFRSPLETY
DVYCYVDHLDAGDVFHITAPNKFTFEEAAEECEAQDARLATVGELQAAWRRGFDQCDYGW
LQDASVRHPVTVARAQCGGGLLGVRTLYRFENQTGFPPPDSRFDAYCFKPSSLNVMPGTD
WGEPAPSAPSEGEVLAEPSQEVIEQPYLEATMAPETLTTTVETMAEATQEELPWEEPITR
RPDHIVTSTVAMPTEATTGLDKDDGEGSAYMVPEDQLVTSAERVPVLETTPDGKVEHLTS
AVTEHKAEVDEMVRTTPGIKPEVFVRPESGEKEAEGSSPTEFTSPSSPFSTTLREEITTK
QREETSLDYIDLGSGLFEVPKGTELPWFSTTEAVVPGDITTASGAVDRRHPTSTARPSSV
PTEEPFLIHRGPGEGITQDLLPLGESTSPLPSTTLTDLIAKKTEADIDREYFETTSSPTQ
PQRTPTVEGREAFRSQAVSTPQPPEGTKFHHDINVYIIEVRENKTGQMSDLSISGHPIDS
ESKEDEPCSEETDPVQNLFDGIYPGIIQIDIYNGEEDGGEDEDCTNATDATTTPSVQYIN
GKQLVTTVPKGPETEEARRGQYESVQPSQNFSDSSESDAHQFVIPETELSTALKPNESKE
SAELLEMTWKPETYPKMSETFSSGEPDIFPTVPFQGGKHPEGEESTTETDPGLENVAPGS
AEPLPLFPEESSGETSTDQVSQIMVFSRATEVTLGEEADRSSAVTYTPSSMVPSSLDPMS
QEGSVTLTGNPQPDEPLSATESGVEITPGQSVEHSGSSSLLFLEGSGEVEEYTDKMFTMA
ADLSPRNTTDVLITLETGKVITTEGFSDIVATTVFSSSELSSAAVESPKFVSEADTSMQV
FSTALEGKGEKETEEEEKGTTGMAFTTESLSPTQRSDQLIPSPELENANVATSSDSSIRQ
GFMPLTTPTQSENSMPSSPLFFTEPELVVNSGAQPFEHNSGSRAGVQEGLTTLPGSLVSL
FMEQGSGEAAVDPETTTLSSFSLNLEPETRAKMEVASTWSPHVESTSSSEPAGRVWTAVT
DSEVTEPINQTSEGKSISESPEEPNHGGGVKGFSTGFPLEEDSSGEFTEYSTVSQPVTEV
SEGSGDGGSTNTQILPSVVSTAGHSHHSSDAGQPHSTTLSTSALLWEELEAFAEGSGGEQ
LITASSSFDPVLPTAVENFSGTDFPFIDQGLEEVSVIHEANQRPTILPSTGAESTAESAE
KKDVKVNSTVSVDFLQTTEPAKSGTRQEGDPLRQGVEGESASEEQIPEHASLKPEQTTFY
SQMLTETGLQTTDYSTKKIPTTDKQVEEEGVSSVPFSIPRADPEASEPYTPLPELPERSE
FYSASAAVTVTEWTPAEVVTDPSTEEEEGIKLFPQGVRPSINNPGTDLLFSGLGSGEELL
STLPPMSVNFTEMERIISTLDPQTPQVESVKTSVLVEKVEDYERVENVDNEVRSFIFKTD
NATKSEEAAPNTTLLEVLGGPGSEEPTTAPVSLSTDTEHPLHETLRWSEEIQTWRQAGPE
QVSPENSSATPSTVFVARTHVLEMTREFITSAPKPSDLLYENSGEGSGEADTLDLAHTSG
TTQASRPETTTFVSDRFLEDHPEAPSAEAGTAHTPPPASTILPLHMEQNRNHPLIQAASP
AHTQSPQRPTEDGADSFPKTILWDLRILKKATENIIIDLDKDDFMLTGTDSPILDILELR
DTTTIIDIDHSRPADEDALGMQTDLDPEVPAGSEESAQATQAQEQHEAAGTLSFTEKAFE
GSGEDASDTQAADNHPVTSESKSQLGHTGFNSPTKISVPSMATEVGILLPTVTSLPTPGK
SATVHPEIKEPKPETTGLDDIFESSTLSDGQAIADQSEVVSTLGDLERTQEEDEEKKHVG
PSFPPDFSSGDEELLTDVTPYVSINHVHLLTQSLTEAPAVQGGPSPSVALSAFEELSHQT
PSSPSSIFPGSGASENTEVPQPSVLPGTDAISTLTSPEHPQNEVHTILEATFKPSGEEQV
PVTKPPSSSPDTELSEDESKPRVFEEAGSSPSEPITKEATKAPQDPTHTDSGPFSGETTE
VLPRLPTYGVEPVPTAGRETESEGAPQWLHSTSTSVTSRVGADVVPQPSPQTSASPTVPF
SWETNPETHAAAFVRGEHSTIAAPEKEMPAGFLDSNSQVTVSTVGLNPELITSSFSLPET
SNETHFLIGIHEEAMEGTAVYFAGPDRCKTNPCLNGGTCYPTETAYVCTCVPGFSGDQCE
LDFDECHSNPCRNGATCVDGFNTFRCLCLPSYIGALCEQDTETCDYGWHKFQGQCYKYFA
HRRTWDAAERECRLQGAHLTSILSHEEQMFVNRVGHDYQWIGLNDKMFEHDFRWTDGSTL
QYENWRPNQPDSFFSAGEDCVVIIWHENGQWNDVPCNYHLTYTCKKGTVACGQPPVVENA
KTFGKMKPRYEINSLIRYHCKDGFIQRHLPTIRCLGNGRWAIPKITCMNPSAYQRTYSKK
YFKNSSSAKDNSVNTSKHDHRWSRRWQESRR
Download sequence
Identical sequences 10141.ENSCPOP00000019567 ENSCPOP00000019567 ENSCPOP00000019567

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]