SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000019568 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000019568
Domain Number 1 Region: 54-200
Classification Level Classification E-value
Superfamily C-type lectin-like 4.02e-46
Family C-type lectin domain 0.00000407
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000019568   Gene: ENSCPOG00000027614   Transcript: ENSCPOT00000022999
Sequence length 210
Comment pep:known scaffold:cavPor3:scaffold_44:12194360:12199239:-1 gene:ENSCPOG00000027614 transcript:ENSCPOT00000022999 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QRGPPAGTQGCLGHSPILLLLQLLSLILLTGLLVAILVPGKGGPGAPRIARTQQQETMNQ
EISQLKVRLAHLCRPCSWDWTLFQGNCYFFSKSLKNWTDSVTACEEMEAQLVIIESDEEQ
RFLLETSKKNGLTWIGLSDRKEEGAWSWMDDSPLLYKFSMYWLEGEPNNIEEEDCAELKG
DGWNDNKCELHKFWICKKPEISCPHNLSQW
Download sequence
Identical sequences 10141.ENSCPOP00000019568 ENSCPOP00000019568 ENSCPOP00000019568

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]