SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000019942 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000019942
Domain Number 1 Region: 131-456
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 2.72e-59
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.000000158
Further Details:      
 
Domain Number 2 Region: 462-595
Classification Level Classification E-value
Superfamily Ricin B-like lectins 2.89e-22
Family Ricin B-like 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000019942   Gene: ENSCPOG00000005588   Transcript: ENSCPOT00000021642
Sequence length 598
Comment pep:known scaffold:cavPor3:scaffold_66:4624290:4657039:-1 gene:ENSCPOG00000005588 transcript:ENSCPOT00000021642 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASLRRVKVLLVLNLIAVAGFVLFLAKCRPIAVRSGDVFHEIRPRAEAANLSAHSVSPIQ
DAVLKRLSLLEDIVYRQLNGLSKSLGLIEGYGGRGRGGLPATLSPAEEEKAKGPHEKYGY
NSYLSEKISLDRSIPDYRPTKCKELKYSKELPQISIIFIFVNEALSVILRSVHSAVNHTP
THLLKEIILVDDNSDEEELKAPLEEYVHKRYPGLVKVVRNQKREGLIRARIEGWKAATGQ
VTGFFDAHVEFTAGWAEPVLSRIQENRKRVILPSIDNIKQDNFEVQRYENSAHGYSWELW
CMYISPPKDWWDAGDPSLPIRTPAMIGCSFVVNRKFFGEIGLLDPGMDVYGGENIELGIK
VWLCGGSMEVLPCSRVAHIERKKKPYNSNIGFYTKRNALRVAEVWMDDYKSHVYIAWNLP
LENPGIDIGDVSERRALRKSLKCKNFQWYLDHVYPEMRRYNNTIAYGELRNNKAKDVCLD
QGPLENHTAILYPCHGWGPQLARYTKEGFLHLGALGTTTLLPDTRCLVDNSKSRLPQLLD
CDKVKSSLYKRWNFIQNGAIMNKGTGRCLEVENRGLAGIDLILRSCTGQRWTIKNSIK
Download sequence
Identical sequences H0V5T8
ENSCPOP00000005034 ENSCPOP00000019942 XP_003465817.1.53824 10141.ENSCPOP00000005034

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]