SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000020714 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000020714
Domain Number 1 Region: 1-308
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 4.71e-66
Family L-arabinose binding protein-like 0.00013
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000020714
Domain Number - Region: 329-403
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00863
Family Growth factor receptor domain 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000020714   Gene: ENSCPOG00000026274   Transcript: ENSCPOT00000022458
Sequence length 668
Comment pep:novel scaffold:cavPor3:scaffold_175:1582813:1589378:-1 gene:ENSCPOG00000026274 transcript:ENSCPOT00000022458 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PQVSHSSTLPSLSDKTQFPSFLRTQASDFVSSLAVIQLVLSLGWSWVIILAQDDEFGQQA
GALAARELEKAGICIEFHLTVPSQHSLEKITCVVQKMQTSTATGVLVFLNNSNFRLILQS
LLGFHPLGQVWVSEGLLHTALALATPGISQILQGAFGLLCHNSQVQGFPEFFSSLHPSQI
PEDVFLVRFWEATFGCKWPHENSTETEDVRLCTGAESLRGHEFPFQDVSEVDIAYTAVYS
VAHALQDLVSCEHGSGVCTDPQHLHPWQLLHPLRKVHFQTHDGTDIMFDTNGDLVTKFDV
LQGQCREKPRPGHWIGENSEPGFLSPLVSQCGCGSNQVPSSVCSTSCEPGFSQIPREGVP
HCCFECHPCPEGQFADQRDMKSCLECPEEQYPSQTRDHCIPRTENFLAFDEPLGLALTSV
SLALASLACLVFGVFLWFRHTPVVRANNRALSYVLLVSLTLCALSPLLFLGRPSPTTCLL
RQTTFAVVFTVAVSCVLAKTLTVVLAFRATRPGQRVRMCLGNSASSSVVLVSSLMQIILC
GVWLGTSPPFPHRDTASEPGHLVLQCQEGSGVAFSCMLGYLGLLAIGTFSVAFLARDLPD
AFNEAKFLTFSMLLFCSVWTAFLPLYHSARGKATVAVEVFSILASTAGLLGGIFLPKCYL
ILLKPEQN
Download sequence
Identical sequences ENSCPOP00000020714 10141.ENSCPOP00000020714 ENSCPOP00000020714

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]