SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000021176 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000021176
Domain Number 1 Region: 7-337
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 7.06e-43
Family L-arabinose binding protein-like 0.0054
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000021176
Domain Number - Region: 349-406
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00816
Family Growth factor receptor domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000021176   Gene: ENSCPOG00000025540   Transcript: ENSCPOT00000025694
Sequence length 668
Comment pep:novel scaffold:cavPor3:scaffold_42:14252648:14259234:1 gene:ENSCPOG00000025540 transcript:ENSCPOT00000025694 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LVVYPHLLYLTFGTYEADFNENGQFPSLHQVAPKDASLALGMVFLMLHFSWTWVGLVIAE
GHNGFQFLSDVRGEMDRNGICVAFVKMISNALVSYLANTEMRDFLTREISPVNVVIIYYD
TDSLNHINHQIGLQLVTWRVWVTNSQWHTDLAGRNFILDSFHGTLIFFQQVQAQPMGSNV
ILIVRQTLLSRSKYRAFHHCSKPINKDHLWKTLNNFILETTVDILFKIYIAFYSHVGIYN
LILQIDVAEAIRKHSLDASVNVPLLNKLHTILKDLQFNSPVGEQVTLDKKSKVDAKYDIL
NFWNFPEGLRFRAKVGEFSPHAPVGQQLSLSEEMIEWATGITETPRSVCSESCDPGFRKS
PQEGKAACCFDCTPCSKNEIANDTDMEQCTPCPDHQYANTERKHCLQKSETFLDYADSLG
KTLAGSALSLTVFTAAVLGLFVKHRDTPIVKANNRALSFGRPSTASCILQWTTFAVVFTV
VVSTVLAKTITVVLAFKVTAPGRRMRQLLVSGAPNCIIPICTLVQLTLCGIWMGTNPPYV
DRDPHSEHGHIIIMCNKGSLTAFYCVLGYLGSLALLSFTVAFLARNLPDTFNEAKFLTFS
MLVFCSVWVTFLPVYHSSKGKVMVAMEVFSILASSAGLLGCIFVPKCYIILLRPERNFSH
RFGDKTHS
Download sequence
Identical sequences ENSCPOP00000021176 ENSCPOP00000021176 10141.ENSCPOP00000021176

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]