SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000021210 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000021210
Domain Number 1 Region: 178-294
Classification Level Classification E-value
Superfamily C-type lectin-like 4.9e-16
Family C-type lectin domain 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000021210   Gene: ENSCPOG00000021138   Transcript: ENSCPOT00000021685
Sequence length 295
Comment pep:novel scaffold:cavPor3:scaffold_70:7177391:7179200:-1 gene:ENSCPOG00000021138 transcript:ENSCPOT00000021685 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQAAWLFGALVVPHLLGFGHGAQGTVKEWEGGWDDALEEEQEREALMLKHLQEALGLLAA
REAENPAATFGHTGTWGTEETQGDEEKEEEATRTPSLIPSPAVGRLASLDTGLHQLHVRL
HVLDTRVVQLTQGLRQLQDTVRNTRDTVEILQQAQGRAERLHGRLEGCLKGLRLGHKCFL
LSLAQPADRQQMEALTRYLRAALAPYNWPVWLGVHDRRAEGLYLFENGQRVSFFAWHRAP
SPEPGAHPSSAPHPLSPNQPNGGVLENCVAQASDDGSWWDHDCERRLYYVCEFPF
Download sequence
Identical sequences ENSCPOP00000021210 10141.ENSCPOP00000021210 ENSCPOP00000021210

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]