SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000000449 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000000449
Domain Number 1 Region: 192-306
Classification Level Classification E-value
Superfamily POZ domain 8.89e-26
Family BTB/POZ domain 0.0017
Further Details:      
 
Domain Number 2 Region: 879-931
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000409
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 3 Region: 649-700
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000103
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 4 Region: 787-839
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000155
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 5 Region: 563-614
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000162
Family Classic zinc finger, C2H2 0.043
Further Details:      
 
Domain Number 6 Region: 686-743
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000212
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 7 Region: 742-802
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000279
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 8 Region: 858-887
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000288
Family Classic zinc finger, C2H2 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000000449   Gene: ENSCPOG00000000510   Transcript: ENSCPOT00000000515
Sequence length 1052
Comment pep:known scaffold:cavPor3:scaffold_35:3722869:3747562:-1 gene:ENSCPOG00000000510 transcript:ENSCPOT00000000515 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSEESYRAILRYLTNEREPYAPGTEGNVKRKIRKAAACYVVRGGTLYYQRRQRHRKTFA
ELEVVLQPERRRGLIEAAHLGPGGTHHTRHQTWHDLSKTYWWRGILKQVKDYIKQCSKCQ
EKLDRSRPISDTSEMLEELGLDLESGEESNESEDDLSNFTSPPATASKSSKKKPVSKHEL
VFVDTKGVVKRSSPKHCQAVLKQLNEQRLSNQFCDVTLLIEGEEYKAHKSVLSANSEYFR
DLFIEKGAISSHEAVVDLSGFCKASFLPLLEFAYTSVLSFDFCSMADVAILARHLFMSEV
LEICESVHKLMEEKQLTVYKKGEVQTVASTQDLPEHPGGTAPPAASSEGTTTTLSNELGD
CEIVLLVNGDLPETEQNEELGQQPEPQVSSEPEAPLSSVECINNSHPEIESVDLITKNNQ
PEPETSNVEEDATGSNSNPKLSKDTIIISSQENSDMENDASTEDVCIEDTSEHRENLSEP
LKDQENLVAPIAKTDSNLDDTYRSRLRQRSVNEGGYIRLHKGMEKKLQKRKTIPKSAVQQ
VAQKLVQRGKKLKQPKRDAKENTEEASHKCGECGMVFQRRYAFIMHTLKHERARDYKCPL
CKKQFQYSASLRAHLIRHTRKDAPSSSSANSTSNEASGTSSEKGRTKREFICSICGRTLP
KLYSLRIHMLKHTGVKPHACQVCGKTFIYKHGLKLHQSLHQSQKQFQCELCVKSFVTKRS
LXSQFSLFTGESKYFCSVCGKSFHRGSGLSKHLKKHQPKPEVRGYHCTQCEKSFFEARDL
RQHMNKHLGVKPFQCQFCDKCYSWKKDWYSHVKSHSVTEPYRCNVCGKEFYEKALFRRHV
KKATHGKKGRAKQNLERVCEQCGRKFTQLREYRRHMNNHEGVKPFECLTCGVAWADARSL
KRHVRTHTGERPYVCPVCSQAYIDARTLRKHMTKFHTDYVPCKIMLEKDTLQFHNQGTQV
EHAVSILTADMQEQESSGPQELETVVVTGETMEVLEAVAATEECPSVSTLSDQSIMQVVN
YVLAQQQGQKLSEVAEAIQTVEVEVAHISEAE
Download sequence
Identical sequences 10141.ENSCPOP00000000449 ENSCPOP00000000449 ENSCPOP00000000449

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]