SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000001175 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000001175
Domain Number 1 Region: 226-518
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase FAD-binding domain 1.44e-95
Family Cryptochrome/photolyase FAD-binding domain 0.0000121
Further Details:      
 
Domain Number 2 Region: 34-243
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase, N-terminal domain 8.24e-55
Family Cryptochrome/photolyase, N-terminal domain 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000001175   Gene: ENSCPOG00000001296   Transcript: ENSCPOT00000001312
Sequence length 603
Comment pep:known scaffold:cavPor3:scaffold_72:5393317:5412959:1 gene:ENSCPOG00000001296 transcript:ENSCPOT00000001312 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AAGAGAVCAEMAAAVGTGTAAAPTPVTGAEGACSVHWFRKGLRLHDNPALLAAVRGARCV
RCVYILDPWFAASSSVGINRWRFLLQSLEDLDTSLRKLNSRLFVVRGQPADVFPRLFKEW
GVTRLTFEYDSEPFGKERDAAIMKMAKEAGVEVVTENSHTLYDLDRIIELNGQKPPLTYK
RFQAIISRMELPKKPVGAVSSQQMESCRAEIQENHDDTYGVPSLEELGFPTEGLGPAVWQ
GGETEALARLDKHLERKAWVANYERPRMNANSLLASPTGLSPYLRFGCLSCRLFYYRLWD
LYKKVKRNSTPPLSLFGQLLWREFFYTAATNNPRFDRMEGNPICIQIPWDRNPEALAKWA
EGKTGFPWIDAIMTQLRQEGWIHHLARHAVACFLTRGDLWVSWESGVRVFDELLLDADFS
VNAGSWMWLSCSAFFQQFFHCYCPVGFGRRTDPSGDYIRRYLPKLKGFPSRYIYEPWNAP
ESIQKAAKCIIGVDYPRPIVNHAETSRLNIERMKQIYQQLSRYRGLCLLASVPSCVEDLS
HPVAEPSLSQAGSSTSTGPRPLPGGPASPKRKLEAAEEPPGEELSKRARVAELPTPEPPS
KDA
Download sequence
Identical sequences 10141.ENSCPOP00000001175 ENSCPOP00000001175 ENSCPOP00000001175

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]