SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000004385 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000004385
Domain Number 1 Region: 490-559
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000188
Family VWC domain 0.0046
Further Details:      
 
Domain Number 2 Region: 1116-1188
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000009
Family VWC domain 0.014
Further Details:      
 
Domain Number 3 Region: 142-204
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000115
Family VWC domain 0.0034
Further Details:      
 
Domain Number 4 Region: 317-382
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000241
Family VWC domain 0.0085
Further Details:      
 
Domain Number 5 Region: 872-939
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000691
Family VWC domain 0.018
Further Details:      
 
Domain Number 6 Region: 204-263
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000188
Family VWC domain 0.019
Further Details:      
 
Domain Number 7 Region: 753-819
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000387
Family VWC domain 0.0084
Further Details:      
 
Domain Number 8 Region: 930-996
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000429
Family VWC domain 0.0057
Further Details:      
 
Domain Number 9 Region: 265-324
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000126
Family VWC domain 0.022
Further Details:      
 
Domain Number 10 Region: 435-498
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000523
Family VWC domain 0.0042
Further Details:      
 
Domain Number 11 Region: 988-1064
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000795
Family VWC domain 0.016
Further Details:      
 
Domain Number 12 Region: 375-429
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000429
Family Fibronectin type I module 0.061
Further Details:      
 
Domain Number 13 Region: 549-610
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000691
Family VWC domain 0.039
Further Details:      
 
Domain Number 14 Region: 703-749
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000126
Family Fibronectin type I module 0.057
Further Details:      
 
Domain Number 15 Region: 608-664
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000136
Family VWC domain 0.024
Further Details:      
 
Domain Number 16 Region: 1457-1522
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000229
Family ATI-like 0.041
Further Details:      
 
Domain Number 17 Region: 812-869
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000046
Family Fibronectin type I module 0.054
Further Details:      
 
Domain Number 18 Region: 1076-1123
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000157
Family VWC domain 0.01
Further Details:      
 
Domain Number 19 Region: 98-139
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000827
Family VWC domain 0.032
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000004385
Domain Number - Region: 62-95
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.051
Family Mitotic arrest deficient-like 1, Mad1 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000004385   Gene: ENSCPOG00000025035   Transcript: ENSCPOT00000004924
Sequence length 1529
Comment pep:novel scaffold:cavPor3:scaffold_11:49350728:49372408:-1 gene:ENSCPOG00000025035 transcript:ENSCPOT00000004924 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAELGGAPLFLLLHLCSLALAAGRVAGGGTVLREPPGLADIHNYQHETPAHSSVAVGSPQ
KQWHPLEERLGRLEAEVTKLREQNKELQARVRQLESCECRPTSAQCWGLGRTWPEGARWE
PDACTACICQNGVARCGPQPDLPHCQGCSHNGQVYGDGEAFSPDACITCRCLAGTVQCQG
PSCSKLNCLESYTPPGECCPVCRPGCEYEGQLYEEGASFLSISNPCLQCSCLRSLVRCVP
VKCPPSPCPKPVQRPGHCCPVCQVPGCTEDGIHRDHGQEWTAPGDPCQICQCLEGRIQCH
QRECASLCPYPARPLPGTCCPVCDGCFLNGREHRSGEPVGSGDPCLRCHCANGSVQCEPL
PCPPVPCRHPGRISGQCCPVCDGCEYQGLQYQSQETFRLQESGLCVRCSCQAGEVSCEEQ
ECPVTPCAPSGSGPRLCPACVLDGEEFAEGVQWEPDGQPCTTCSCQDGVPICGPVLCSPP
PCQHPTQLPGACCPSCESCTYHGHPYASGQNFTDTEDPCQACHCKDGTVRCSVINCPPTT
CARPQSQPGQCCPRCPDCILEKQVFIDGQRFSHPGDPCQECHCQEGLARCQPRPCPRAPC
AHPLPGTCCQSDCSGCAFGGKEYPSGADFPHPSDPCRLCLCLSGSVQCLARRCPPLRCPE
PALPQGRGVRRVAEQTLHLVHARGTPGDPGPRPRAASPLLASAGCRYHGKEFASGERFPE
PGAACHECLCWEGTVTCEPRPCAPAQCPFPARGDCCPACDGCEYLGESYLSSQDFPDPQE
PCNVCTCLGGFVTCSRRPCEPPGCIHALTPLGHCCPVCQGCFYHGVTAAPGETLPDPLDP
TCSLCTCQEGSMRCQRRPCRPAPCPHPSPGPCFCPVCRSCHFRGQEHQDGKEFEGPAGSC
ERCRCQAGQVSCARLQCPPLPCLHQVTEPGSCCPRCRGCLAHGEEHPEGSSWVLPDSPCS
SCMCHEGIVTCAHIQCVSSCAQPHLEPGDCCPRCSGCEHEGRKYEAGESFQPGADPCEVC
ICEPQPEGPPSLRCHRRQCPSLVGCPPSQLLLPEPQHCCPTCAQALSNCTESLLGSELAP
TDPCYTCRCQDLTWLCIRRTCPELSCPPLEHHTPPGSCCPVCQASTQSCEHQGRQVASGE
HWTVDVCTNCSCMAGTVHCHSQHCPPPSCSSNEAPALSPGSCCPRCLPRPASCMAFGDPH
YRTFDGRLLHFQGSCSYVLVKDCHGGDFSVHVTNDDRGRSGVAWTQEVAVLLGDVAVQLL
QGRTVLVDQRPVALPFLQEPLLYVELWGQTVILHAWLGLQVLWDGRSQVEVRVPGSYRGH
TCGLCGNFNGFAQDDLQGPNGLLLPTEAAFGNSWQVPDGPESGQPCSAGREVDPCRAAGY
RARREANVRCGQLKSSSFSRCHAVVPPEPFFAACVYDLCACGPGPSADACLCDALQAYAS
HCRQAGVTPVWRGPTLCVVGCPLDRGFVFDECGPPCPRTCFNQHIPLEELAAHCVRPCVP
GCQCPAGLVEHEGHCIPPDACPPVLFTGA
Download sequence
Identical sequences ENSCPOP00000004385 ENSCPOP00000004385 10141.ENSCPOP00000004385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]