SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000004636 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000004636
Domain Number 1 Region: 197-492
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase FAD-binding domain 1.83e-94
Family Cryptochrome/photolyase FAD-binding domain 0.0000166
Further Details:      
 
Domain Number 2 Region: 5-215
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase, N-terminal domain 3.53e-54
Family Cryptochrome/photolyase, N-terminal domain 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000004636   Gene: ENSCPOG00000005154   Transcript: ENSCPOT00000005209
Sequence length 596
Comment pep:novel scaffold:cavPor3:scaffold_140:46888:103473:-1 gene:ENSCPOG00000005154 transcript:ENSCPOT00000005209 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGVNAVHWFRKGLRLHDNPALKECIRGADTIRCVYILDPWFAGSSNVGINRWRFLLQCLE
DLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKKLASEA
GVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLISKMEPLEIPVETITSEVVEKCVT
PLSDDHDEKYGVPSLEELAGFDTDGLPSAVWPGGETEALTRLERHLERKAWVANFERPRM
NANSLLASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLLWREFFYTA
ATNNPRFDKMEGNPICVQIPWDRNPEALAKWAEGRTGFPWIDAIMTQLRQEGWIHHLARH
AVACFLTRGDLWVSWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFHCYCPVGFG
RRTDPNGDYISKRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMVHHAEAS
RLNIERMKQIYQQLSRYRGLGLLASVPSNPNGNGGLLGYAPGESTPGSGGGSCVPGSSSA
GVSHCAQGEAPQAPPGLRLLCAGRDPAGPGLGGGKRPSQEEDAQSTGHKIQRQSPD
Download sequence
Identical sequences ENSCPOP00000004636 ENSCPOP00000004636 10141.ENSCPOP00000004636

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]