SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000004654 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000004654
Domain Number 1 Region: 131-454
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 1.41e-64
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.0000000239
Further Details:      
 
Domain Number 2 Region: 477-607
Classification Level Classification E-value
Superfamily Ricin B-like lectins 5.09e-29
Family Ricin B-like 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000004654   Gene: ENSCPOG00000005174   Transcript: ENSCPOT00000005229
Sequence length 608
Comment pep:known scaffold:cavPor3:scaffold_32:1483889:1508524:1 gene:ENSCPOG00000005174 transcript:ENSCPOT00000005229 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSVTVRYFCYGCLFTSATWTVLLFVYFNFSEVTQPFKNVPIKGSGPHGPFPKKFYPRFT
RGPSRMLDPQFKPNRIDDVIDNQVEDPEKDHQKFSSELGMIFNERDQELRDLGYQKHAFN
VLISNRLGYHRDVPDTRNAACKEQSYPADLPVASVVICFYNEAFSALLRTVHSVLDRTPA
YLLHEIILVDDDSDFDDLKGELDEYVQKSLPTKIKVIRNAKREGLIRGRMIGAAHATGEV
LVFLDSHCEVNEMWLQPLLATIRGDPHTVVCPVIDIISADTLAYSSSPVVRGGFNWGLHF
KWDLVPLSELGGEDGATAPIKSPTMAGGLFAMNRQYFNELGQYDSGMDIWGGENLEISFR
IWMCGGKLFIIPCSRVGHIFRKRRPYGSPEGQDTMTHNSLRLAHVWLDEYKDQYFSLRPD
LKTKSYGNISERVELRKRLGCRSFKWYLDNIYPEMQVQGPNAKAQQPVFVNRGPKRPRVL
RRGRLYHFQTNKCLVAQGRPSQKGSLVVLKACDYRDPAQVWIYNEEHELVLNNLLCLDVS
ETRSSDPPRLMKCHGSGGSQQWTFGKNNWLYQVSVGQCLTVVDPLGQKGSVAMAICHGFP
SQQWHLEG
Download sequence
Identical sequences H0V4U9
ENSCPOP00000004654 10141.ENSCPOP00000004654 XP_003469821.1.53824 ENSCPOP00000004654

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]