SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000007838 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000007838
Domain Number 1 Region: 52-235
Classification Level Classification E-value
Superfamily L domain-like 1.09e-32
Family Ngr ectodomain-like 0.011
Further Details:      
 
Domain Number 2 Region: 275-355
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000001
Family I set domains 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000007838   Gene: ENSCPOG00000008731   Transcript: ENSCPOT00000008809
Sequence length 497
Comment pep:novel scaffold:cavPor3:scaffold_9:52685057:52686622:1 gene:ENSCPOG00000008731 transcript:ENSCPOT00000008809 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLRLHALPTLPGVVRPGCRELLCLLVITVTVSPGASGVCPTACICATDIVSCTNKNLSK
VPGNLFRLIKRLDLSYNRIGPSISAGSFSTTPNLKCLDLSSNKLKTVKSAVFQELKDLEV
LLLYNNHLSYLDPSAFGGLSQLQKLYLSGNFLTQFPMDLYVGRFKLAELMFLDVSYNRIP
SIPMHHINLVPGKQLRGIYLHGNPFICDCSLYSLLIFWYRRHFSSVMDFKNDYTCRLWSG
SRQSSQLLLLQDSFMNCSDSIVNGSFRALGLIHEAQVGERLVVHCDSKTGDGNTDFVWVG
PDNRLLEPEKEMENFHVFYNGSLVIESPRFEDAGVYSCIAMNRQRLLNETVDVTINVGNF
TVNRSHAHEAFNTAFTTLAACVASIVLVLLYLYLTPCPCKCKTKRQKNMLNQSNAQSSIL
TPGPASDASTDERKAGAGKRVVFLEPLKDTAAGQNGKVRLFASETVIAEGILKSTRVKSD
SDSVNSVFSDTPFVAST
Download sequence
Identical sequences ENSCPOP00000007838 10141.ENSCPOP00000007838 ENSCPOP00000007838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]