SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000012699 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000012699
Domain Number 1 Region: 32-268
Classification Level Classification E-value
Superfamily L domain-like 1.77e-36
Family Ngr ectodomain-like 0.0038
Further Details:      
 
Domain Number 2 Region: 279-358
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000023
Family V set domains (antibody variable domain-like) 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000012699   Gene: ENSCPOG00000014097   Transcript: ENSCPOT00000014239
Sequence length 492
Comment pep:known scaffold:cavPor3:scaffold_2:33670019:33671497:-1 gene:ENSCPOG00000014097 transcript:ENSCPOT00000014239 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPQCDLRGLWLLLLSLYLLLSEVARAGRPVVSCPAACLCASNILSCSKQQLPNVPHSLP
SYTALLDLSHNNLSRLRAEWTPTRLTHLHSLLLSHNHLNFISSEAFSPVPNLRYLDLSSN
QLRTLDEFLFSELQALEVLLLYNNHIMTMDRYAFDDMAQLQKLYLSQNQISRFPLELVNE
RAKLPKLTLLDLSSNKLNKLPLSDLQKLPAWIKNGLYLHNNPLECNCKLYQLFSHWQYRQ
LSSVMDFQEDLYCVRSKELHNVFNLSFLNCSEYKESAWEADLGETFTIKCDTRQQGMTKV
WVTPSNERVLDKVANGTVTVKDGNLHFNKVQVEDGGVYTCYAMGETFNETLSVELKVYNF
TLHGHHDTLNTAYTTLVGCILSVVLVLIYLYLTPCRCWCRGVEKPSSHQGDSLSSSMLST
TPNHDPMAGGDKDDGFDRRVAFLEPAGPGQGQNGKLKPGNTLPVPEATSKGQRRMSDPES
VSSVFSDTPIVV
Download sequence
Identical sequences A0A286XZD4
ENSCPOP00000012699 ENSCPOP00000012699 10141.ENSCPOP00000012699 XP_003479036.2.53824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]