SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000012913 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000012913
Domain Number 1 Region: 42-227
Classification Level Classification E-value
Superfamily L domain-like 2.89e-40
Family Ngr ectodomain-like 0.0056
Further Details:      
 
Domain Number 2 Region: 256-291,320-374
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000805
Family I set domains 0.095
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000012913
Domain Number - Region: 527-566
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00129
Family Fibronectin type III 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000012913   Gene: ENSCPOG00000014337   Transcript: ENSCPOT00000014479
Sequence length 716
Comment pep:known scaffold:cavPor3:scaffold_147:1041318:1043501:1 gene:ENSCPOG00000014337 transcript:ENSCPOT00000014479 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVPLRALWFAWALPAVVRACPEPCACVDKYAHQFADCAYKELREVPEGLPANVTTLSLSA
NKITVLRRGAFVNVTQVTSLWLAHSEVRTVEPGALAVLSQLKNLDLSHNLITNFPWSDLR
NLSALQLLKMNHNRLGSLPRDALGALPDLRSLRINNNRLRTLEPGTFDALGALSHLQLYH
NPFHCGCGLLWLQAWAASTRVSLPEPDSIACASPPALKGVPVHRLPALPCAPPSVRLSAE
PPLEALGTPLRSGLAFTVHCVAEGHPTPRLQWQLQIPGGTVVLEVPAQSKEDDEEGAEDG
AEDGDGEVPTQTEAPTPTPAPAWPAPPATPRFLALANGSLFVPLLSAKEAGVYTCRAYNE
LGVNSTSVRVAVAAAGPPKHASGVGGDPDRQVPTSERKVTAKGRGNSVLPSKPEGKAKGQ
GTARVSTLEAELEEEADGGGEVEDQIPGNPAEEQHCGHGNPFRYVSNHAFNQSSELKPHV
FELGVIALDVAEREARVQLTPLAARWGPGPGGAAGAGHSGRRPLRLLYLCPAGGGAAVQW
SRVEEGVNTYWFRGLRPGTNYSVCLALAGEACHVQVVFATKKELPSLLIIVTVSVFLLML
ATVPLLGATCCHLLRPQAPDPMEKHIAADFDPRASYLESEKSYQAVGGEGVEEAQGKELD
EDPEEGLAACSLVESQSKANQEEFEAGSEYSDRLPLGAEAVNLAQEINGNYRQTAG
Download sequence
Identical sequences ENSCPOP00000012913 10141.ENSCPOP00000012913 ENSCPOP00000012913

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]