SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000014038 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000014038
Domain Number 1 Region: 13-243
Classification Level Classification E-value
Superfamily L domain-like 5.87e-44
Family Ngr ectodomain-like 0.015
Further Details:      
 
Domain Number 2 Region: 238-342
Classification Level Classification E-value
Superfamily Immunoglobulin 1.54e-16
Family I set domains 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000014038   Gene: ENSCPOG00000015568   Transcript: ENSCPOT00000015720
Sequence length 490
Comment pep:known scaffold:cavPor3:scaffold_95:3637457:3640195:-1 gene:ENSCPOG00000015568 transcript:ENSCPOT00000015720 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TSCPRCLYCYSATVECGALRLRVIPQGIPPGTQTLFLQDNSITRLEPGTLAPLSSLRHLY
LHNNSLRALESGAFHAQPRLLELALTGNQLRGLRGAAFAGLVQLRVLYLAGNQLVRLLDF
TFLHLARLQELHLQENSIELLEDQALAGLSSLALLDLSRNQLGTISQEALQPLASLQVLR
LTENPWRCDCALHWLGAWIKEGGQRLLSSRDKKIMCAEPPRLAMQSLLDISGSSLICIPP
SVHVEPLVVTANLGEDLRVACQASGYPQPLVTWRKVPQPRENRPQAQAQLESGMPTLGGH
GAPDTGSGMLFLTNITLAHAGKYECEAANAGGAARIPFRLLVNATRPHRLAPLAPVVRPA
DHEPQHETGSMAFRALGLATQTAIAGAIALLALTALLLAAMICRRRRRRKKARAPPGEGT
LFVNDYSDGPCTFAQLEELRDERGHEMFVIDRSKPLFVEGPVETPEDRSTTEGLAPMSRL
PPRVAYEIHC
Download sequence
Identical sequences ENSCPOP00000014038 ENSCPOP00000014038 10141.ENSCPOP00000014038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]