SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000014519 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000014519
Domain Number 1 Region: 1309-1480
Classification Level Classification E-value
Superfamily C-type lectin-like 2.29e-70
Family Endostatin 0.000000068
Further Details:      
 
Domain Number 2 Region: 214-409
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.45e-33
Family Laminin G-like module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000014519   Gene: ENSCPOG00000020725   Transcript: ENSCPOT00000023475
Sequence length 1485
Comment pep:known scaffold:cavPor3:scaffold_110:4225064:4251460:-1 gene:ENSCPOG00000020725 transcript:ENSCPOT00000023475 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPKPSGCLVLLLACCLTPTWATLLPLEWLWSSTTSDSTATPVSQPQGHPSQRGPTEPTT
APASTQLALKEQEVTWSKSSASHVTPSSLAASAGSLDLKEEENIAGVGAKILNVAQGIRS
FIQLWDDAAPTGASAATSTPTEPHTLEGPYSDSQDSGPTLWSNLGAPWVLGTQTAEAGAL
AMPTQLPPSLGRSPALPRGSPVSPVPAESTSQEVGLLQLLGEPLPQQITAISDPEVGPAY
IFGPDANNGQVARYHVPSPFFRDFSLLFHVRPDTGAAGMLFAITDASQAAVMLGVKLSGV
QDQHQNISLLYMEPGASQTRTAASFRLPAFVGQWTRFALSVEGSSVALYVDCEEFQRLPF
TRSPRGLELEPGAGLFVGQAGGADPDKFQGAIAELWVRADPRVSPVRCQDEEDEDEDRAS
GDLGSGLEEHQELHREDVVVTQTPSLPPPPPVTTPPLARGGRDEREREEETAEARAKGSD
GSHLSSLGKTLPGNEWDKRALSPGSSLETGGLKGQKGEPGAQGPPGPVGPQGPVGPGMHS
PDTHSVPGPQGPPGHPGPPGKDGAPGRDGEPGDPGEDGRPGDAGPQGFPGTPGDVGPKGE
KGDPGVGPRGPPGPQGPPGPPGPSFRHDKLTFVDMEGSGFSGDLETLRGPRGFPGPPGPP
GVPGLPGEPGRFGVNGSHVPGPPGLPGVSGRDGAPGFPGSPGPPGPPGREGPPGRAGEKG
TLGNAGAPGPKGSKGDPGPVGAPGENGFQGFAAGFDDMEGSGAPFWSTARGSAELQGPPG
LPGLKGDPGVPGPPGDKGEVGADGTRGFPGLPGSEGPAGPMPLQGPKGEKGSPGEKGDPG
KDGVGQPGLPGPPGPPGPVVYVSEQDRALASVPGPEGRPGFAGFPDPGASPGPGSEPGRL
DGPGPKGEKGEPGGIFGPDSRALGPVQKGAKGEPGFRGPPGPYGRPGHKGEIGFPGRPGR
PGMNGLKGEKGEPGDATLGFGMRPAAGGHSRSGPAAPRRTPVYDSNAFVESSRPGPPGAQ
GLPGPSGPKGDKGDVGQPGPPGKFPLDLFHLGAEMKGEKGERGDAGQKGERGAPGASSGF
FGSSVPGPPGPPGYPGIPGPKGESIRGPPGPPGPQGPPGIGYEGLPGPHTQSKQWGWLGT
ALSPGCHRSPWRLGFSPCSYQPPGPPGAMGTSSGVRAWTTYEAMLEKVREVPEGWLIFVA
EDEELYVRVRNGVRKVLLEARMPLPPETDNEVAALQPPLVQLHEGGPYPRREHSYSTARP
WRADDILASPPRLPDPRPYPGVPHHHGAYVHLRPTSPTGSAAHSHQDFQPVLHLVALNSP
LPGGMRGIRGADFQCFQQARAVGLSGTFRAFLSSRLQDLYSIVRRADRGAVPIVNLRDEV
LSPSWEALFSGSQGQLKPGARIFSFDGRDVLRHPAWPQKNVWHGSDPSGRRLTESYCEAW
RTEAVAATGQASSLLSGRLLEQSASSCRKAYIVLCIENSFMMPSK
Download sequence
Identical sequences 10141.ENSCPOP00000015676 ENSCPOP00000014519 ENSCPOP00000015676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]