SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000015752 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000015752
Domain Number 1 Region: 31-236
Classification Level Classification E-value
Superfamily L domain-like 3.83e-34
Family Ngr ectodomain-like 0.0028
Further Details:      
 
Domain Number 2 Region: 284-359
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000128
Family I set domains 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000015752   Gene: ENSCPOG00000020283   Transcript: ENSCPOT00000026460
Sequence length 472
Comment pep:novel scaffold:cavPor3:scaffold_8:24796784:24798316:-1 gene:ENSCPOG00000020283 transcript:ENSCPOT00000026460 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAWRVLLVVLLCMLRFRLGTPDSEGFLPPTLHNCPYKCICAANLLSCAGLGLQDVPATLP
SAAEDLDLSHNALRLLRPGWLAPLSRLRALHLSHNKLDVLGRGIFSNASRLKLLDLSANA
LRALGRHDLHGLGALETLLLFNNRLTRLDEHAFHGLRVLGHLYLGYNELSSFSFNHLHGL
GTTHLRTLDLSSNQLGLISISELAILPAFLKNGLYLHNNPLPCDCRLYHLLHRWHQRGLR
AVRDFAHEYTCLAFKVPASGVRFFEHSRIFENCSAAPALGLEQPEEQLHAQVGGSLRLYC
NTSAPAVSVAWVSPQHELLLAPGSRDGSITVLADGSLAISTVQQEHAGIFVCLATGPHLH
HNQTLEYNVSVHFPHPEPEAFNTGFTRLRAPSPLQELSAQSSVLSTTSPDAPSRKASVHK
HVVFLEPSRRGLNGRVQLAVAEDFDLCTLSGLPLQAGSESVSSTGSEGLMMT
Download sequence
Identical sequences ENSCPOP00000015752 ENSCPOP00000015752 10141.ENSCPOP00000015752

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]