SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000018626 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000018626
Domain Number 1 Region: 35-232
Classification Level Classification E-value
Superfamily L domain-like 1.32e-39
Family Ngr ectodomain-like 0.0053
Further Details:      
 
Domain Number 2 Region: 248-343
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000463
Family I set domains 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000018626   Gene: ENSCPOG00000014271   Transcript: ENSCPOT00000014413
Sequence length 429
Comment pep:known scaffold:cavPor3:scaffold_147:1074882:1076171:1 gene:ENSCPOG00000014271 transcript:ENSCPOT00000014413 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGLCLLCWALLLGLVRGCPEACDCGEKYGFQIADCAYRDLEAVPPGFPANVTTLSLSAN
RLPGLPEGAFGEVPLLQSLWLAHNEIRKVAIGALAPLGHLKSLDLSHNLLSDFAWSDLHN
LSALQLLKMDSNELTFIPRDAFRSLRALRSLQLNHNRLHTLAEGTFAPLTALSHLQINDN
PFDCNCGLVWLKTWALATAVSIPEQDNVACTSPHMLKGTPLSRLPPLPCSAPSVQLSYQP
SQDGAELRPGFVLALHCDVDGQPAPQLHWHIQTPGGTVEIASPNVGTDGHVLPGAPAVPG
GRPRFQAFANGSLLIPDFGKLEEGTYSCLATNELGGAESSVNVALATTGEGGEDALGRRF
HGKAVEGKGCYTVDNEVQPSGPEDNVVIIYLSCARNPEAAVLGKGAAGQWCPGLVLVLVP
SLLLLGVPF
Download sequence
Identical sequences H0W6M2
10141.ENSCPOP00000018626 XP_003462252.2.53824 ENSCPOP00000018626 ENSCPOP00000018626

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]