SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000018781 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000018781
Domain Number 1 Region: 184-333
Classification Level Classification E-value
Superfamily Retrovirus capsid protein, N-terminal core domain 1.26e-22
Family Retrovirus capsid protein, N-terminal core domain 0.0078
Further Details:      
 
Domain Number 2 Region: 340-420
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 2.56e-20
Family Retrovirus capsid protein C-terminal domain 0.0012
Further Details:      
 
Domain Number 3 Region: 1-88
Classification Level Classification E-value
Superfamily Retroviral matrix proteins 8.12e-18
Family Mason-Pfizer monkey virus matrix protein 0.00059
Further Details:      
 
Domain Number 4 Region: 461-481
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000879
Family Retrovirus zinc finger-like domains 0.0019
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000018781
Domain Number - Region: 438-458
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00732
Family Retrovirus zinc finger-like domains 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000018781   Gene: ENSCPOG00000019473   Transcript: ENSCPOT00000022882
Sequence length 492
Comment pep:novel scaffold:cavPor3:scaffold_742:24706:26296:-1 gene:ENSCPOG00000019473 transcript:ENSCPOT00000022882 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQSFSSPFLKILKHLLSMYGISLRLTDLEMYVHTIKEYNPWFPDEGTLDVELWRRARAS
IENAMRQDEKIPLCFWAIWSVVYSLLKAMEDEHIVENLQQEIKPVIHELPLTEAEQTVVQ
NDAIALTSEKASKPKAVQCLTQVVEQLYIKQSLPIYPSAPPPSNPDCKKTKLALANMPET
GDSEDEETSVFAFPVIRPQPADGVTPPPRWEGFNIKIKKAVTLYGPQAHYTRELLMAVAD
RYGNLAPYDWRTLAKILLKEPEYLQWHMWFMEGCAEKARQNAEDRDPNVRLIFYPMLSGT
GFYDTVEHQAVAPREIHAQLRNIALEAWDKMWPQGSEYESWAKVLQGTNEPYVEFIARLQ
NVIEKTIVGKDLQQHLLKLLAFENANDECKKVLIPIKNTGTIDNFIKQCKDLSSESKKMQ
LFAETMVTTWNNLQSKKFGCGQTGHVNRACPKLSGKKSKTPGLCPKCHKGRHWYCECRSK
QVNSAEQKGNGK
Download sequence
Identical sequences ENSCPOP00000018781 ENSCPOP00000018781 10141.ENSCPOP00000018781

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]