SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000019338 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000019338
Domain Number 1 Region: 50-188
Classification Level Classification E-value
Superfamily C-type lectin-like 3.54e-30
Family C-type lectin domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000019338   Gene: ENSCPOG00000020355   Transcript: ENSCPOT00000020721
Sequence length 382
Comment pep:known scaffold:cavPor3:scaffold_19:36199156:36219639:-1 gene:ENSCPOG00000020355 transcript:ENSCPOT00000020721 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LDPGPSEAYQKCLISYLKKSIRDAEGRLQSASHLDPRGGQLVCRGGTQRPCYKVIYFRDA
SRRLDFEEAKEACRRDGGQLVSIESEDEQKLIKTFIENLLASDGDFWIGLRRHEEKQSNS
TACQDLYAWTDGSTSKFRNWYVDEPSCGSEICVVMYHQPSAPAGIGGPYMFQWNDDRCNM
KNNFICKYSDEKPTAPSTRLGGERTEPATPVLPKETQTEDAKETFEENKGAPLNLAYILI
PSVPLLLLVVTTVICWVWICKKRRQEQPDLSTKEQHTLWPSLYQENNPDLEVYNVIRKQS
EADLAEPRPDLKNISFRVHSGEATPDDMSCDYDNMAVNPSESGFITLASAESGFVTNDIY
ELSPDQKPMSGSSGWPAHQQFS
Download sequence
Identical sequences ENSCPOP00000019338 10141.ENSCPOP00000019338 ENSCPOP00000019338

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]