SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000004129 from Ictidomys tridecemlineatus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000004129
Domain Number 1 Region: 13-93
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 1.15e-17
Family HLH, helix-loop-helix DNA-binding domain 0.0000129
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000004129   Gene: ENSSTOG00000004613   Transcript: ENSSTOT00000004600
Sequence length 151
Comment pep:novel scaffold:spetri2:JH393471.1:2593047:2593499:1 gene:ENSSTOG00000004613 transcript:ENSSTOT00000004600 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RSDKDDIQVESKDDKRAHHNALEQKRKDPIKDSFHSLQDSVPSLQGDKASRAQILDKATE
EIQYMQRKNHTHQQDTDGLERQNALLEQQVRALQKARSSAQLQTNYPCSDNSLYTNPRGS
TISASDGGSDSGSEREPEEPQNGKKLRMEAP
Download sequence
Identical sequences ENSSTOP00000004129 ENSSTOP00000004129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]