SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000000432 from Ictidomys tridecemlineatus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000000432
Domain Number 1 Region: 18-100
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.91e-20
Family Ubiquitin-related 0.00037
Further Details:      
 
Domain Number 2 Region: 556-602
Classification Level Classification E-value
Superfamily UBA-like 0.0000000000179
Family UBA domain 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000000432   Gene: ENSSTOG00000000484   Transcript: ENSSTOT00000000480
Sequence length 604
Comment pep:novel scaffold:spetri2:JH393907.1:119321:121135:1 gene:ENSSTOG00000000484 transcript:ENSSTOT00000000480 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTHVISRTPKMPQRGRSSGLPADRTISSVTRVIVKTPGNLKDFIVADDTSVRQFKEKLSA
HFKCQMDQLVLVFMGRLLKDHDTLSQRGIVDGHTIHLVIKSKHGSRSLAHSSRNLPVSEP
CHGDRNTKGNSSGVCKSASMSQTPTESDLFVKTDAPKVRTQDLKVDTSECIARILENPNI
QRLQSNMEYMRQFISEHPDMQQLMQQNPEVSHLLDNSEILYQTLELARNLAVIQEIMQTQ
QPAQNPEHPLNTLGFETIPGGNNALSQSYTDFNDRMLNNLKDPFGGNPFTALLAGQAPEQ
LQTSPTILPPSQEWRDQLPQLPTTKVIYTSSRGFSSISTNGISTNATPNRVNHTSTISTN
DQSPVHDTEIAALPSKEVTQKSQEEDQDATISIDSPEQKLEEDPQLSDEQNSSQIAGGMM
QLLMNNPHLAAQMMFMGMPQLNDQWKQQLPTFLQQSQLSDLLLALTNPKASQAILQIEQG
LQLLATEAPVLLPWVAPYSWGLGCLSAPNCNYPDPMHWAWNMPDIPESKRSECCHVPGTV
LQKLQSLAGDPSHFLQAPEIRFSKQMESLQAMGFGNHHANLQALIATEGDTNAAIRKLMR
SQGF
Download sequence
Identical sequences ENSSTOP00000000432 XP_005342537.1.77405 ENSSTOP00000000432

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]