SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000000766 from Ictidomys tridecemlineatus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000000766
Domain Number 1 Region: 125-305
Classification Level Classification E-value
Superfamily HAD-like 3.79e-30
Family NLI interacting factor-like phosphatase 0.081
Further Details:      
 
Domain Number 2 Region: 4-80
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.53e-20
Family Ubiquitin-related 0.0000151
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000000766   Gene: ENSSTOG00000000854   Transcript: ENSSTOT00000000855
Sequence length 318
Comment pep:novel scaffold:spetri2:JH393325.1:4094339:4108527:-1 gene:ENSSTOG00000000854 transcript:ENSSTOT00000000855 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALPIIVKWGGQEYSVTTLSEDDTVLDLKQFLKTLTGVLPERQKLLGLKVKGKPAENDVK
LGALKLKPNTKIMMMGTREESLEDVLGPPPDNDDVVNDFDIEDEVVEVENREENLLKISR
RVKEYKVEILNPPREGKKLLVLDVDYTLFDHRSCAETGVELMRPYLHEFLTSAYEDYDIV
IWSATNMKWIEAKMKELGVSTNANYKITFMLDSAAMITVHTPRRGLIDVKPLGVIWGKFS
EFYSKKNTIMFDDIGRNFLMNPQNGLKIRPFMKAHLNRDKDKELLKLTQYLKEIAKLDDF
LELNHKYWERYLSKKQGQ
Download sequence
Identical sequences A0A250XYB9 G1SH30 G5BEN2
HGL_H00000296786 ENSSTOP00000000766 ENSSTOP00000000766 XP_002710392.1.1745 XP_004836528.1.39548 XP_005325488.1.77405 XP_005376307.1.28644 XP_008253560.1.1745 XP_012620420.1.48125 XP_012620421.1.48125 XP_012663140.1.62490 XP_012934105.1.39548 XP_015348147.1.40921 XP_017196719.1.1745 XP_020020048.1.5219 ENSOCUP00000001916

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]