SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000004742 from Ictidomys tridecemlineatus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000004742
Domain Number 1 Region: 47-163
Classification Level Classification E-value
Superfamily FKBP-like 1.05e-34
Family FKBP immunophilin/proline isomerase 0.000000426
Further Details:      
 
Domain Number 2 Region: 2-39
Classification Level Classification E-value
Superfamily WW domain 0.000000000000949
Family WW domain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000004742   Gene: ENSSTOG00000005299   Transcript: ENSSTOT00000005291
Sequence length 163
Comment pep:novel scaffold:spetri2:JH393469.1:309582:321309:1 gene:ENSSTOG00000005299 transcript:ENSSTOT00000005291 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGSKNGQGEPARVRCSHL
LVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARG
DLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Download sequence
Identical sequences I3M5T9
ENSSTOP00000004742 ENSSTOP00000004742

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]