SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000006995 from Ictidomys tridecemlineatus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000006995
Domain Number 1 Region: 291-536
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.45e-90
Family Eukaryotic proteases 0.0000236
Further Details:      
 
Domain Number 2 Region: 201-297
Classification Level Classification E-value
Superfamily SRCR-like 1.31e-19
Family Hepsin, N-terminal domain 0.064
Further Details:      
 
Weak hits

Sequence:  ENSSTOP00000006995
Domain Number - Region: 180-203
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0017
Family LDL receptor-like module 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000006995   Gene: ENSSTOG00000007794   Transcript: ENSSTOT00000007813
Sequence length 544
Comment pep:novel scaffold:spetri2:JH393352.1:3029167:3048244:-1 gene:ENSSTOG00000007794 transcript:ENSSTOT00000007813 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQEGGQRDFCPPAPSPRAFHTWPPALRPPLRVPVGEPGPALSLPLLMSSQNASPARTPPA
RASPARTSPARAPSRSSSGGSSSARSASTTSSPTRVCLVRATPVGAVPVRASPARSAPAT
RASGESPGLGLPKFSWQESQKQLPLIGCVLLLIALVVALILLFYFWRGHTGIKYKEPVES
CPKHAVRCDGVVDCKLKSDELGSVRFDWDQSLLKVYSGSSHEWLPVCSSSWNDSDSERTC
RQLGFESAYRTTEVAHRDFASSFSISEYNSTIQESLRRSECPSQQYVSLQCSHCGLRAIT
GRIVGGTLTSENKWPWQVSLHYGNTHICGGTLIDAQWVLTAAHCFFVTREKILDGWKVYA
GTHNLHQLPEAASISQIIINGNYTDEQDDYDIALVRLSKPLTLSSHIHPACLPMYGQTFS
LNETCWITGFGKTKETDEKTSPFLREVQVSLIDFKKCNDYSVYDSYLTPRMMCAGDLRGG
RDSCQGDSGGPLVCEQNNRWYLAGVTSWGTGCGQRNKPGVYTKVTEVLPWIYSKMESEVR
FRKS
Download sequence
Identical sequences ENSSTOP00000006995 ENSSTOP00000006995

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]