SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000007867 from Ictidomys tridecemlineatus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000007867
Domain Number 1 Region: 196-443
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.09e-87
Family Eukaryotic proteases 0.000089
Further Details:      
 
Domain Number 2 Region: 100-203
Classification Level Classification E-value
Superfamily SRCR-like 3.79e-19
Family Hepsin, N-terminal domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000007867   Gene: ENSSTOG00000008775   Transcript: ENSSTOT00000008777
Sequence length 445
Comment pep:novel scaffold:spetri2:JH393422.1:884201:894241:1 gene:ENSSTOG00000008775 transcript:ENSSTOT00000008777 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVQCAEKGPAPAISRAEPRDQPQPISKVGRWCSVRRGCVVLGALGLLAGAGVGSWLLVL
YLWPAASQPISGTLQDEEMMLNCSGASNEEVLLPSIPKAVSFRINSGDFLLEVKVRARPA
WLLVCHEGWNPALGMRICQSLGHLRLIHHKGVNLSDTMLNSSQKFARLSPSLEGFLKEVW
QLRDNCTSGQVVSLKCSECGTRPLASRIVGGHAVALGRWPWQASVTLGSRHTCGGSVLAP
HWVMTAAHCIHSFRLFRLSSWRVHAGLVSHSTIKPHQGAMVEKIISHPLYSAQSHDYDVA
LLRLRIPLNFSETVGAVCLPAEEQHFPSGSQCWVSGWGHTDPSHTYSSDTLQDTVVPLLS
TQLCNSSCIYSGALTPRMMCAGYLDGRADACQGDSGGPLVCPDGGKWHLVGVVSWGRGCA
EPNHPGVYAKVAEFLDWIHKTVQVS
Download sequence
Identical sequences ENSSTOP00000007867 ENSSTOP00000007867

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]