SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000010123 from Ictidomys tridecemlineatus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000010123
Domain Number 1 Region: 30-227
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.25e-38
Family Laminin G-like module 0.0017
Further Details:      
 
Domain Number 2 Region: 267-333
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000262
Family VWC domain 0.012
Further Details:      
 
Domain Number 3 Region: 476-584
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000643
Family Growth factor receptor domain 0.0091
Further Details:      
 
Domain Number 4 Region: 682-754
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000555
Family VWC domain 0.024
Further Details:      
 
Domain Number 5 Region: 427-468
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000322
Family EGF-type module 0.014
Further Details:      
 
Domain Number 6 Region: 589-631
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000123
Family EGF-type module 0.02
Further Details:      
 
Domain Number 7 Region: 334-391
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000596
Family VWC domain 0.031
Further Details:      
 
Weak hits

Sequence:  ENSSTOP00000010123
Domain Number - Region: 392-426
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00758
Family EGF-type module 0.033
Further Details:      
 
Domain Number - Region: 624-687
Classification Level Classification E-value
Superfamily FnI-like domain 0.0115
Family VWC domain 0.025
Further Details:      
 
Domain Number - Region: 765-802
Classification Level Classification E-value
Superfamily FnI-like domain 0.0774
Family VWC domain 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000010123   Gene: ENSSTOG00000011270   Transcript: ENSSTOT00000011282
Sequence length 810
Comment pep:novel scaffold:spetri2:JH393464.1:1591708:2392064:1 gene:ENSSTOG00000011270 transcript:ENSSTOT00000011282 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPMDVILVLWFCVCTARTVVGFGMDPDLQMDFITELDLVNTTFGVTQVSGLHNASKAFLF
QDTEREIHAAPHVSEKLIQLFRNKSEFTFLATVQQKPSTSGVILSIRELEHSYFELESSG
LRDEIRYHYIHKGKPRTEALPYRMADGQWHKVALSVSASHLLLHVDCNRIYERVIDTPET
NLPPGSNLWLGQRNQKHGLFKGIIQDGKIIFMPNGYITQCPNLNRTCPTCSDFLSLVQGI
MDLQELLAKMTAKLNYAETRLSQLENCHCEKTCQVSGLLYRDQDSWVDGDHCRNCTCKSG
AVECRRMSCPPLNCSSESLPVHIAGQCCKVCRPKCIYGGRVLAEGQRILTKSCRECRGGV
LVKITEMCPPLNCSEKDHILPENQCCSVCRGHNFCAEAPKCGENSECKNWNTKATCECKN
GYISIQGDSAYCEDIDECAAKMHYCHANTVCVNLPGLYRCDCVPGYIRVDDFSCTEHDEC
GSGQHNCDENAICTNTVQGHSCTCKPGYVGNGTICKAFCEEGCRYGGTCVAPNKCVCPPG
FTGSHCEKDIDECTEGIIECHNHSRCVNLPGWYHCECRSGFHDDGTYSLSGESCIDIDEC
ALRTHTCWNDSACINLAGGFDCLCPSGPSCSGDCPHEGGLKHNGQVWTLKEDRCSVCSCK
DGKIFCRRTACDCQNPSVDLFCCPECDTRVTSQCLDQNGHKLYRSGDNWTHSCQQCRCLE
GEVDCWPLACPNLSCEYTAMVEGECCPRCVSDPCLADHIAYDIRKTCLDSYGVSRLSGAV
WTMAGSPCTTCKCKNGRVCCSVDLECLQNN
Download sequence
Identical sequences I3MH09
ENSSTOP00000010123 XP_005336016.1.77405 ENSSTOP00000010123

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]