SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000010344 from Ictidomys tridecemlineatus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000010344
Domain Number 1 Region: 219-511
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase FAD-binding domain 8.11e-96
Family Cryptochrome/photolyase FAD-binding domain 0.0000121
Further Details:      
 
Domain Number 2 Region: 26-210
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase, N-terminal domain 1.16e-54
Family Cryptochrome/photolyase, N-terminal domain 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000010344   Gene: ENSSTOG00000011521   Transcript: ENSSTOT00000011526
Sequence length 596
Comment pep:novel scaffold:spetri2:JH393372.1:3144154:3168471:-1 gene:ENSSTOG00000011521 transcript:ENSSTOT00000011526 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RAVMAAAVVTAAATVPTPATSADGASSVHWFRKGLRLHDNPALLAAVRGARCVRCVYILD
PWFAASSSVGINRWRFLLQSLEDLDTSLRKLNSRLFVVRGQPADVFPRLFKEWGVTRLTF
EYDSEPFGKERDAAIMKMAKEAGVEVVTENSHTLYDLDRIIELNGQKPPLTYKRFQAIIS
RMELPKKPVGAVSSQQMESCKAEIQEDHDDTYGVPSLEELGFPTEGLGPAVWQGGETEAL
ARLDKHLERKAWVANYERPRMNANSLLASPTGLSPYLRFGCLSCRLFYYRLWDLYKKVKK
NSTPPLSLFGQLLWREFFYTAATNNPRFDRMEGNPICIQIPWDRNPEALAKWAEGKTGFP
WIDAIMTQLRQEGWIHHLARHAVACFLTRGDLWVSWESGVRVFDELLLDADFSVNAGSWM
WLSCSAFFQQFFHCYCPVGFGRRTDPSGDYIRRYLPKLKGFPSRYIYEPWNAPESIQKAA
KCIIGVDYPRPIVNHAETSRLNIERMKQIYQQLSRYRGLCLLASVPSCVEDLSHPVAEPG
SSQAGSISSTGPRPLSSGQASPKRKLEAAEEPPGEELSKRARVAELPTPELPSKDA
Download sequence
Identical sequences ENSSTOP00000010344 ENSSTOP00000010344

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]