SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000011017 from Ictidomys tridecemlineatus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000011017
Domain Number 1 Region: 32-292
Classification Level Classification E-value
Superfamily YWTD domain 3.01e-54
Family YWTD domain 0.00000163
Further Details:      
 
Domain Number 2 Region: 644-899
Classification Level Classification E-value
Superfamily YWTD domain 3.14e-54
Family YWTD domain 0.00000608
Further Details:      
 
Domain Number 3 Region: 343-573
Classification Level Classification E-value
Superfamily YWTD domain 4.05e-50
Family YWTD domain 0.00000255
Further Details:      
 
Domain Number 4 Region: 945-1161
Classification Level Classification E-value
Superfamily YWTD domain 1.57e-29
Family YWTD domain 0.00019
Further Details:      
 
Domain Number 5 Region: 1338-1374
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000654
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 6 Region: 1259-1299
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000249
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 7 Region: 1300-1336
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000314
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 8 Region: 599-645
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000141
Family EGF-type module 0.01
Further Details:      
 
Domain Number 9 Region: 902-953
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000176
Family EGF-type module 0.02
Further Details:      
 
Domain Number 10 Region: 297-340
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000324
Family EGF-type module 0.008
Further Details:      
 
Domain Number 11 Region: 1218-1269
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000136
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000011017   Gene: ENSSTOG00000012285   Transcript: ENSSTOT00000012295
Sequence length 1618
Comment pep:novel scaffold:spetri2:JH393409.1:1746406:1815507:-1 gene:ENSSTOG00000012285 transcript:ENSSTOT00000012295 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SRTSGTSRPPPAHPPFLVIVLKLGCLQAGASPLLLFANRRDVRLVDAGGVKLESTIVVSG
LEDAAAVDFQFSKGAVYWTDVSEEAIKQTYLNHSGAATQNVVISGLVSPDGLACDWVGKK
LYWTDSETNRIEVANLNGTSRKVLFWQDLDQPRAIALDPAHGYMYWTDWGETPRIERAGM
DGSTRKIIVDSDIYWPNGLTIDLEEQKLYWADAKLSFIHRANLDGSFRQKVVEGSLTHPF
ALTLSGDTLYWTDWQTRSIHACNKRTGEKRKEILSALYSPMDIQVLSQERQPSFHTQCEE
DNGGCSHLCLLSPREPFYTCACPTGVQLQEDGRTCKAGAEEVLLLARRTDLRRISLDTPD
FTDIVLQVDDIRHAIAIDYDPLEGHVYWTDDEVRAIRRAYLDGSGAQTLVSTEINDPDGI
AVDWVARNLYWTDTGTDRIEVTRLNGTSRKILVSEDLDEPRAIVLHPVMGLMYWTDWGES
PKIECAHLDGRERRVLVNTSLGWPNGLALDLQEGKLYWGDAKTDKIEVINVDGTERRTLL
EDKLPHIFGFTLLGDFIYWTDWQRRSIERVHKVKASRDVIIDQLPDLMGLKAVNVAKVIG
TNPCAEGNGGCSHLCFFTPRATKCGCPIGLELLSDMRTCIVPEAFLVFTSRAAIHRISLE
TNNNDVAIPLAGVKEASALDFDVSNNHIYWTDVSLKTISRAFMNGSSVEHVIEFGLDYPE
GMAVDWMGKNLYWADTGTNRIEVARLDGQFRQVLVWRDLDNPRSLALDPTKGYIYWTEWG
GKPRIVRAFMDGTNGMTLVDKVGRANDLTIDYADQRLYWTDLDTNMIESSNMLGQDRVVI
ADDLPHPFGLTQYSDYIYWTDWNLHSIERADKTSGRNRTLIQGHLDFVMDILVFHSSRQD
GLNDCMHNNGQCGQLCLAIPGGHRCGCASHYTLDPSSRNCSPPSAFLLFSQKCAISRMIP
DDQRSPDLILPLHGLRNVKAIDYDPLDKFIYWVDGRQNIKRAKDDGTQPFVLTSPGQSQN
LSPDRQPHDLSIDIYSRMLFWTCEATNTINVHRLDGDAMGVVLRGERDRPRAIAVNAERG
YLYFTNMQDRAAKIERAALDGTEREVLFTTGLIRPVALVVDNTLGRLFWVDADLKRIESC
DLSGSLLFSLFASNSIQVRSLCVLGLQHCHSEDRQRRVVAVGAMGAGMPISPVLLFSLQV
YVNFHIIEGNSGLLGTAHPCARDNGGCSHICIAKGDGTPRCSCPVHLVLLQNLLTCGEPP
TCSPDQFACATGEIDCIPGAWRCDGFPECDDQSDELGCPVCSAAQFPCARGQCVDLRLRC
DGEADCQDRSDEAHCDAICLPNQFRCASGQCVLIKQQCDSFPDCMDGSDELMCEITKPPS
DDTPAHSSAIGPVIGIILSLFVMGGVYFVCQRVVCQRYAGASGPFPHEYVSGTPHVPLNF
IAPGGSQHGPFTGISCSKSMMSSVSLMGGRSGPPLYDRNHVTGASSSSSSSTKATLYPPI
LNPPPSPATDPSLCNMDMFYSSNIPATARPYRPYIIRGMAPPATPCSTDVCDSDYSTSRW
KASKYYLDLNSDSDPYPPPPTPHSQYLSAEDSCPPSPVTERSYCHLFPPPPSPCTDSS
Download sequence
Identical sequences ENSSTOP00000011017 ENSSTOP00000011017

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]