SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000016085 from Ictidomys tridecemlineatus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000016085
Domain Number 1 Region: 196-490
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase FAD-binding domain 1.31e-95
Family Cryptochrome/photolyase FAD-binding domain 0.0000159
Further Details:      
 
Domain Number 2 Region: 5-214
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase, N-terminal domain 2.22e-54
Family Cryptochrome/photolyase, N-terminal domain 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000016085   Gene: ENSSTOG00000020498   Transcript: ENSSTOT00000027185
Sequence length 621
Comment pep:novel scaffold:spetri2:JH393302.1:7929379:7995721:1 gene:ENSSTOG00000020498 transcript:ENSSTOT00000027185 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGVNAVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPWFAGSSNVGINRWRFLLQCLE
DLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKKLATEA
GVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLISKMEPLEIPVETITSEVIEKCTT
PLSDDHDEKYGVPSLEELGFDTDGLSSAVWPGGETEALTRLERHLERKAWVANFERPRMN
ANSLLASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLLWREFFYTAA
TNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEGWIHHLARHA
VACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFHCYCPVGFGR
RTDPNGDYIRRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMVNHAEASRL
NIERMKQIYQQLSRYRGLGLLASVPSNPNGNGGLMGYAPGENIPGCSSSGREAIQMSALQ
GTSKDTPRMAKLKRTPNDSHLSHYWAKGSSILHNAHGDSQQTHLLKQGRSSMGTGLSSGK
RPSQEEDTQSIGPKVQRQSTN
Download sequence
Identical sequences ENSSTOP00000016085 ENSSTOP00000016085

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]