SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000016366 from Ictidomys tridecemlineatus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000016366
Domain Number 1 Region: 924-1029
Classification Level Classification E-value
Superfamily PDZ domain-like 1.13e-28
Family PDZ domain 0.00092
Further Details:      
 
Domain Number 2 Region: 438-543
Classification Level Classification E-value
Superfamily Second domain of FERM 7.2e-26
Family Second domain of FERM 0.0009
Further Details:      
 
Domain Number 3 Region: 544-652
Classification Level Classification E-value
Superfamily PH domain-like 7.38e-26
Family Third domain of FERM 0.0042
Further Details:      
 
Domain Number 4 Region: 766-861
Classification Level Classification E-value
Superfamily PDZ domain-like 8.94e-23
Family PDZ domain 0.017
Further Details:      
 
Domain Number 5 Region: 1047-1159
Classification Level Classification E-value
Superfamily PDZ domain-like 3.02e-20
Family PDZ domain 0.032
Further Details:      
 
Domain Number 6 Region: 344-433
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000000362
Family First domain of FERM 0.017
Further Details:      
 
Weak hits

Sequence:  ENSSTOP00000016366
Domain Number - Region: 75-159
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.000393
Family Protein kinases, catalytic subunit 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000016366   Gene: ENSSTOG00000027720   Transcript: ENSSTOT00000023439
Sequence length 1299
Comment pep:novel scaffold:spetri2:JH393538.1:1953778:2049736:1 gene:ENSSTOG00000027720 transcript:ENSSTOT00000023439 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LVPCPGDAGMSLASVTLASVLQVRGEALSEEELWSLLSLAAERLLEDLHNDSSDYVVCPW
SALLSATGSLSFQDHVSHIEAAPFKAPELLQGQGEDELLDVSQMHVYSLGMTLYWTAGFH
VPPNQPLQLHEPLHSILLTMCEDQPSRRRPLQSILEACRVHQEEVAVYPAPAQLHIRRLV
GLVLGTISEMERRVVEESTCMQQSRSYLLRKRLQGTSSESPVAPALECLNLLRVSDRSTE
TQSSLEPRWSTSAHSRCSLFVNSTLAGTFPHDQQEGQRLCPGSVLLAEAGSSQLPAPSQR
NFLQRKKKFSRPEFLLLAGEAPVTLHLPGSVVTKKGKSYLTLRDLCVVLLSGQCLEVKCD
IESTVGAVFNAVMSFINLGEITYFGLAYLKGKEFFFLNNETRLCKIAPEGWREQLMKTST
DTFTLFLRIKFFVSHCGLLQDSLTRHQFYLQLRKDILEERLHCNDETLLQLGVLALQAEF
GNYPKEQTESKAYFRVEDYIPASLIERMTALQVQVEVSEMHRLCSAPWGEDAELEFLRII
QQLPEYGVLVHQIFPEKKRPEEELALGICAKGVIVYEVKNNSRIATLRFWWRETGKISTY
RKKFTITSSVTGKKHTFVTDSAKTCKYLLGLCSAQHGFNAQMGSGQILHISADRDKFVQM
ANSSPAQQAQSKPLTWIQRLSCSENQLFLPRLQDTIGGLLSASLENFNLETNKETGPEGI
RDSPCPGQEQLNSTCLIQKPMTRGPLSGLPFQTVNTGFQNNRRKSGSAEPGREIVHVTLK
RDRHRGFGFVINEGEDRGQSNPGIFISSIIPGGPAEKAKTIKPGGQILALNHISLEGFTF
NMAVRMIQNSPDNIELVISQSKGVCGNNPCEGVFSTNILSNQGNQGSLSSRTQDQDRTIG
ELKVAQLQSSMPQLSSLPLKGQGSSCPPSPSETNTDRIYFVELVKEDGTLGFSVTGGINT
SVLYGGIYVKSIIPGGPAAKEGQILQGDRLLQVDGVSLCGLTHKQAVQYLKGPGQVVRLV
LERRGPRTAQQCPSANDRMGDEHAAVSLVTALPGRPVSCVSVTDGLKFEVKLKKNINGLG
FSFVQMERENCSHLKNDLVRIKRLFPGQPAEEHGAIAVGDIILAVNGRPTEGLLFQEVLH
LLRGAPQEVTLLLCRPPPGVLPEMEQGWQISALSADKELTRATCTDSEHSPSLDQEDRWR
DSASLDAGEDLNLRPESFYKATSEAQGGQDREKLWAGSLTRPLESHPHLCKLHQEMEPPI
LATSLENDLRQNCYSVCDIRRLGRFSFSSSLTRLATDIL
Download sequence
Identical sequences ENSSTOP00000016366 ENSSTOP00000016366

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]