SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000016798 from Ictidomys tridecemlineatus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000016798
Domain Number 1 Region: 351-417
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000736
Family IBR domain 0.024
Further Details:      
 
Domain Number 2 Region: 431-485
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000972
Family RING finger domain, C3HC4 0.0066
Further Details:      
 
Domain Number 3 Region: 52-129
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000017
Family Ubiquitin-related 0.011
Further Details:      
 
Domain Number 4 Region: 280-323
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000265
Family RING finger domain, C3HC4 0.032
Further Details:      
 
Domain Number 5 Region: 191-219
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.0000000288
Family Ran binding protein zinc finger-like 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000016798   Gene: ENSSTOG00000026501   Transcript: ENSSTOT00000024134
Sequence length 509
Comment pep:novel scaffold:spetri2:JH393295.1:18057294:18072574:-1 gene:ENSSTOG00000026501 transcript:ENSSTOT00000024134 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEKFKKAEEMALSLARAVAGGDEQAAMKCAIWLAEQRVPVSVKLKPEVSLTQDIRLCVS
VEDAQMHTVTIWLTVRPDMTVASLKDMVFLDYGFPPTLQQWVIGQRLARDQETLHSHGVR
RNGDSAYLYLLSACNTSLNPRELQRERQLRMLEDLGFKDLTLQPRGPLEPDPSKSGAPQE
PGQQPDAVPEPPPVGWQCPGCTFINKPTRPGCEMCCQARPETYQVPTSYQPDAEERARLA
SEEEALRQYQQRKQQQQEGNYLQHVQLEQRSLVLNTEPAECPVCYSVLAPGEAVVLRECL
HTFCRECLQGTIRNCQEAEVSCPFIDNTYSCPGKLLEREIRALLSPEDYQRFLDLSVSIA
ENRSAFSYHCKTPDCKGWCFFEDDVNEFTCPVCFHVNCLLCKAIHERMNCREYQDDLALR
AQNDVAARQTTEMLRVLLQQGEAMHCPQCHIVVQKKDGCDWIRCTVCHTEICWVTKGPRW
GPGGPGDTSGGCRCRVNGIPCHPSCQNCH
Download sequence
Identical sequences A0A287DFU1
ENSSTOP00000016798 XP_013211946.1.77405 XP_021578905.1.77405 XP_021578906.1.77405 ENSSTOP00000016798

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]