SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000017056 from Ictidomys tridecemlineatus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000017056
Domain Number 1 Region: 143-405
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.77e-86
Family Eukaryotic proteases 0.0000000126
Further Details:      
 
Domain Number 2 Region: 57-157
Classification Level Classification E-value
Superfamily SRCR-like 0.0000000000000811
Family Hepsin, N-terminal domain 0.00000377
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000017056   Gene: ENSSTOG00000028691   Transcript: ENSSTOT00000028691
Sequence length 416
Comment pep:novel scaffold:spetri2:JH393380.1:1171234:1186875:-1 gene:ENSSTOG00000028691 transcript:ENSSTOT00000028691 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEKEGGRTVPCCSGPKVAALIVGTLLLLTGIGAASWAIVTLLLRSDQEPLYPVQASPVD
ARLTVFDQTEGTWRLLCSSRSNARVAGLGCEEMGFLRALAHSELDVRTAGANGTSGFFCV
DEGRLPHAQRLLDVISVCDCPRGRFLATVCQDCGRRKLPVDRIVGGQDTSLGRWPWQVSL
RYDGAHLCGGSLLSGDWVLTAAHCFPERNRVLSRWRVFAGAVAQASPQGMQLGVQAVVYH
GGYLPFRDPSSEENSNDIALVHLSSPLPLTEYIQPVCLPAADQALVDGKICTVTGWGNTQ
YYGQQARVLQEARVPIMSTDVCNGPDFYGNQIKPKMFCAGYPEGGIDACQGDSGGPFVCE
DSISRTPRWRLCGIVSWGTGCALAQKPGVYTKVSDFREWIFQAIKTHSEASGMVTQ
Download sequence
Identical sequences ENSSTOP00000017056 ENSSTOP00000017056

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]