SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000018345 from Ictidomys tridecemlineatus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000018345
Domain Number 1 Region: 536-748
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.09e-48
Family DBL homology domain (DH-domain) 0.00039
Further Details:      
 
Domain Number 2 Region: 227-371
Classification Level Classification E-value
Superfamily PH domain-like 8.61e-43
Family Third domain of FERM 0.00054
Further Details:      
 
Domain Number 3 Region: 867-1026
Classification Level Classification E-value
Superfamily PH domain-like 3.22e-33
Family Pleckstrin-homology domain (PH domain) 0.0016
Further Details:      
 
Domain Number 4 Region: 733-858
Classification Level Classification E-value
Superfamily PH domain-like 3.08e-30
Family Pleckstrin-homology domain (PH domain) 0.0058
Further Details:      
 
Domain Number 5 Region: 126-229
Classification Level Classification E-value
Superfamily Second domain of FERM 5.63e-27
Family Second domain of FERM 0.00013
Further Details:      
 
Domain Number 6 Region: 45-126
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.89e-21
Family First domain of FERM 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000018345   Gene: ENSSTOG00000022815   Transcript: ENSSTOT00000022940
Sequence length 1066
Comment pep:novel scaffold:spetri2:JH393555.1:427375:855038:-1 gene:ENSSTOG00000022815 transcript:ENSSTOT00000022940 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGEIEGTYRVLQSAGMRLSTQTPMGVSTLEPGQTLSPRMQEKHLHIRVKLLDNTVETFDT
EPKCTGQLLLMQVWKRLNLIECDYFGLEFQNVQSHWIWLEPMKPIIRQVRRPKNAVLRLA
VKFFPPDPGQLQEEYTRYLFALQLKRDLQEERLACTATTAALLTAHLLQAEIGDYDEALD
REHLKAHEYLPGQECCLEKVLDFHRRHMGQTPAESDFQVLEIARKLEMYGIRFHTASDRE
GTKINLAVSHMGVLVFQGTTKINTFNWSKVRKLSFKRKRFLIKLHPEVHGPYQDTLEFLL
GSRDECKNFWKICVEYHTFFRLLDQPKPKAKAVFFSRGSSFRYSGRTQKQLAEYVRDGGV
RRTPYERWHSKTQASLRALTADLPKQSISLAEGLKTSASLSPANVSWGPFLSSPGSPPGL
PSFEDSSSPLIDPPAPDAKRAASEWSRRAAAGGPGLPSAPPPGPPEPQLAPGLSVDGAQP
SSSSQRSPLSLHPILQVTLGPAEQGLGPLLSPALSEAAGAQTQDQEEPLHKLMPEDEAYF
IAKEILATERTYLKDLEVLTVWFRSAVAKEGAMSAALMTLLFSSIDPVYKFHRGFLHEVE
HRLALWEVPPGTNTPGDHQRIGDVLLPAMRQLKELTSYFQRHDEVLTELDKATKRCRKLE
LLYQEFELQKVCYLPLSAFLLKPLQRLVRYRLLLSRLCQHHPPGHRDHADCRDALKTITE
VTTTLQHSLTRLENLQKLMELQRELVGVDSLVAPGREFIREGCLHKLTKKGLQQRMFFLF
SDVLLYTSKSAAGTSHFRIRGLLPLRGMLVEESESQWAAPYCFTIYAAQKTVVVAASTQQ
EREKWMLDLNAAIQAARSSSTPFPELPGGILCTQAPRSSDETSPEQESEEDARGTRGSLE
GQVQHRANTMMHVCWYRNTSVSRADHSAAVENQLSGYLLRKFKNGDGWQKLWVVFTNFCL
FFYKTHQDDHPLASLPLLGYSVSVATEADGIHKDYVFKLQFKSHIYFFRAESKYTFERWM
EVIQRAGTSPGRPPRFLQDCPHAASGSEGAVREEEEDIEPCLECGA
Download sequence
Identical sequences ENSSTOP00000018345 ENSSTOP00000018345

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]