SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000022807 from Ictidomys tridecemlineatus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000022807
Domain Number 1 Region: 15-99
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.37e-24
Family Ubiquitin-related 0.00000974
Further Details:      
 
Domain Number 2 Region: 600-654
Classification Level Classification E-value
Superfamily UBA-like 0.000000000000365
Family UBA domain 0.00096
Further Details:      
 
Weak hits

Sequence:  ENSSTOP00000022807
Domain Number - Region: 188-238
Classification Level Classification E-value
Superfamily ARM repeat 0.0259
Family Mo25 protein 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000022807   Gene: ENSSTOG00000027136   Transcript: ENSSTOT00000027876
Sequence length 655
Comment pep:novel scaffold:spetri2:JH393907.1:127845:129812:1 gene:ENSSTOG00000027136 transcript:ENSSTOT00000027876 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKSGEALPQGSPAPVQDPHLIKVTVKTPKDKEDFSVTDTCTIQQLKEEISQRFKAHPDQ
LVLIFAGKILKDPDSLAQCGVRDGLTVHLVIKMQRRAMGPECPAASVPTPGPSPGSLPQP
SSIYPTDGPPTFSLGVLAGLNGLGVTSGSFPDQPNSLMWQHVSVPEFVAQLIDDPFIQGL
LSNTGLVRQLVLDNPHMQQLIQHNPEIGHILNNPEIMRQTLEFLRNPAMMQEMMRSQDRA
LSNLESIPGGYNVLRTMYTDIMDPMLNAVQEQFGGNPFATTTTTNSTSSSNQPSRTENCD
PLPNPWTSTYGGSGARRGRQSGDQDASEIRSRVPNFLGNIGLYDYLQQLHETPQSLGTYL
QGTASTLNPRQEPPSPGNRIPPTSSSSQEPGSGQPLPKESVTIKGKSSCPAFLRYPSESS
TGQGRGQDGTGKDSTNHNTSMPDLVSGLGDSANRAPFGPSPPSPMTTTAGVPEPPWMPPP
GYPRFLRPAGLNHAPHLQDDIHQQLPLLLHLQAAMANPRAMQALLQIEQGLQILATEAPR
LLLWFMPCLAGLGGGAGGTESREGGFMSEDPRPAPAPQVSPAQGSSELGFHSTPFLQMLQ
ALANASPQQLQPEAHFRAQLEQLRAMGFLNPEANLQALIATGGDVDAAVEKLRQS
Download sequence
Identical sequences I3NEL0
ENSSTOP00000022807 XP_005342538.1.77405 ENSSTOP00000022807

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]