SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|334345695|ref|YP_004554247.1| from Sphingobium chlorophenolicum L-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|334345695|ref|YP_004554247.1|
Domain Number 1 Region: 20-251
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.49e-51
Family Extended AAA-ATPase domain 0.000000293
Further Details:      
 
Domain Number 2 Region: 256-330
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 8.71e-23
Family Helicase DNA-binding domain 0.00097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|334345695|ref|YP_004554247.1|
Sequence length 339
Comment Holliday junction ATP-dependent DNA helicase ruvB [Sphingobium chlorophenolicum L-1]
Sequence
MSEDRLISSTRRVEDVDAALRPKSLAEFIGQQAARENLRIFIEAAKGRGEALDHVLFFGP
PGLGKTTLAQIVAREMGVGFRATSGPVIAKSGDLAALLTNLDEGDVLFVDEIHRLNPAVE
EVLYPAMEDRALDLMIGEGPSARSVRIDLPPFTLVGATTRQGLLTTPLRDRFGIPVRLQF
YTVDELELVVRRAARLLDLAITSDGAVEIARRSRGTPRIAGRLLRRVRDFANVAGAPAVD
AKVADAALTRLEVDHLGLDLMDRRYLMMIADIYRGGPVGVETLAAGLSEARDTIEEVIEP
YLIQLGLIARTARGRCLNGPGWKHLGLNPPSNVQDGLFD
Download sequence
Identical sequences F6EVT9
gi|334345695|ref|YP_004554247.1| WP_013847985.1.77199

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]