SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|219682686|ref|YP_002469069.1| from Bifidobacterium animalis subsp. lactis AD011

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|219682686|ref|YP_002469069.1|
Domain Number 1 Region: 11-171
Classification Level Classification E-value
Superfamily Nudix 2.03e-22
Family MutT-like 0.072
Further Details:      
 
Domain Number 2 Region: 181-304
Classification Level Classification E-value
Superfamily Phosphoglycerate mutase-like 0.0000000000045
Family Cofactor-dependent phosphoglycerate mutase 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|219682686|ref|YP_002469069.1|
Sequence length 353
Comment MutT protein [Bifidobacterium animalis subsp. lactis AD011]
Sequence
MSEKRTVEAAGGIVYRIVRSIGSMMAPLSANDVEVCLVHRPKYDDWSWPKGKLEINESHR
HAAVREIGEETGFPVALGPFLGEVEYPLSSEGKKTRHTGRGDGKDATKHVLYWMATQISD
DDNWHRREAFGPIHAVDLGEVSEIAWLSLDKARKRLTHSTDRDMLALFVDRIEEDALKAT
PLLLVRHAKAEPRKQWDGTEPHRPITPEGAAAAYALDRELACYNPVELATSPWTRCEQTI
EMLSWQTKRERRALPPLTEEAFERDPQAAWHCFAEQIKRVLETGNTMAICMHRPVIGGMF
EHLRPLCATKSLAKRLVAKSPYMATANAFALFLVQTEDGPRIIDIQKVTPIVY
Download sequence
Identical sequences B8DVJ2 D3R3A2
gi|384191625|ref|YP_005577372.1| WP_012619661.1.14456 WP_012619661.1.20477 WP_012619661.1.22654 WP_012619661.1.23267 WP_012619661.1.23846 WP_012619661.1.23969 WP_012619661.1.26294 WP_012619661.1.34099 WP_012619661.1.38287 WP_012619661.1.38998 WP_012619661.1.45260 WP_012619661.1.45775 WP_012619661.1.47471 WP_012619661.1.47549 WP_012619661.1.50484 WP_012619661.1.53490 WP_012619661.1.62237 WP_012619661.1.66072 WP_012619661.1.75174 WP_012619661.1.78909 WP_012619661.1.86686 WP_012619661.1.86797 WP_012619661.1.94304 442563.BLA_0191 gi|452892178|ref|YP_005579009.2| gi|219682686|ref|YP_002469069.1| gi|384190488|ref|YP_005576236.1| gi|518656656|ref|YP_008143018.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]