SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|219683063|ref|YP_002469446.1| from Bifidobacterium animalis subsp. lactis AD011

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|219683063|ref|YP_002469446.1|
Domain Number 1 Region: 85-172
Classification Level Classification E-value
Superfamily Nudix 0.0000018
Family NADH pyrophosphatase 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|219683063|ref|YP_002469446.1|
Sequence length 200
Comment ADP-ribose pyrophosphatase [Bifidobacterium animalis subsp. lactis AD011]
Sequence
MPDDGDFDAGRSRGEFDHITPEDITRGTGNPPGWLGADDIADLRSRMPIAYVEIVPVRVD
DFGRVTQIGSLLRVANDQSIVERTLIAGRVLYHESLREAIARNISKDMGELALPVLPQTL
TPFTVAEFFPTPGVSPYFDARQHAIALCYVVPIAGDCKPQDETLDVEWVDPHGPQITEFI
EQMNDGHGTIVRQALAWVNL
Download sequence
Identical sequences B8DWL9
gi|387822940|ref|YP_006302889.1| 442563.BLA_0573 gi|219683063|ref|YP_002469446.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]