SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|219683866|ref|YP_002470249.1| from Bifidobacterium animalis subsp. lactis AD011

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|219683866|ref|YP_002470249.1|
Domain Number 1 Region: 22-126
Classification Level Classification E-value
Superfamily Nudix 2.98e-18
Family MutT-like 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|219683866|ref|YP_002470249.1|
Sequence length 177
Comment MutT/nudix family protein [Bifidobacterium animalis subsp. lactis AD011]
Sequence
MTEEPLSLELEDAEWPFEYIDHDRPIARAIVIDAHAYFYFLRVQRTDVFGNAVTIETSGG
GIEPGETPTEAVMREVREELGAEIEILGEIGLVSDCYNRIHRHNINHYYLCQALSFGETN
LTELERTRFNLSTLKLTYAQAIAEYRRCEDSKLGRLIAARELPMLERAWGMLGKLGY
Download sequence
Identical sequences A0A2G9IQS4 B8DUJ4
WP_004217895.1.14456 WP_004217895.1.20477 WP_004217895.1.22654 WP_004217895.1.23267 WP_004217895.1.23846 WP_004217895.1.23969 WP_004217895.1.26294 WP_004217895.1.34099 WP_004217895.1.38287 WP_004217895.1.38998 WP_004217895.1.45260 WP_004217895.1.45775 WP_004217895.1.47471 WP_004217895.1.47549 WP_004217895.1.50484 WP_004217895.1.53490 WP_004217895.1.62237 WP_004217895.1.66072 WP_004217895.1.75174 WP_004217895.1.78909 WP_004217895.1.86686 WP_004217895.1.86797 WP_004217895.1.94304 gi|219683866|ref|YP_002470249.1| gi|384195460|ref|YP_005581205.1| gi|387820769|ref|YP_006300812.1| 442563.BLA_1388 555970.Balat_0872 580050.Balac_0872 gi|241196308|ref|YP_002969863.1| gi|241190902|ref|YP_002968296.1| gi|384193897|ref|YP_005579643.1| gi|518657283|ref|YP_008143645.1| gi|387822443|ref|YP_006302392.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]