SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|219683968|ref|YP_002470351.1| from Bifidobacterium animalis subsp. lactis AD011

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|219683968|ref|YP_002470351.1|
Domain Number 1 Region: 21-190
Classification Level Classification E-value
Superfamily Nudix 1.25e-31
Family MutT-like 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|219683968|ref|YP_002470351.1|
Sequence length 209
Comment NTP pyrophosphatase in MutT family [Bifidobacterium animalis subsp. lactis AD011]
Sequence
MSKQTYRRFDPWRSTPIQEEARETIVGGHYFNIDRVSLTSPTVGHFERLILHKNNGDSVG
VIGLTKDGRVPLIEQYRIPVHRWTLEIPAGHAVDKGERPIDVAHRKLAEEVGYKAGVMTQ
FCRFINTPSYSTQHTALYFAYDLEPIDEREQYANEARAQVRFLTPQECYELVLNGTILDA
KSIIAIQRLYMAPNHMIGVSPYDGAPARD
Download sequence
Identical sequences A0A2G9IR08 B8DUU6
gi|384194002|ref|YP_005579748.1| gi|549472454|ref|YP_008606161.1| gi|241191010|ref|YP_002968404.1| gi|241196416|ref|YP_002969971.1| 442563.BLA_1493 555970.Balat_0982 580050.Balac_0982 gi|518657386|ref|YP_008143748.1| gi|219683968|ref|YP_002470351.1| gi|387820876|ref|YP_006300919.1| gi|387822551|ref|YP_006302500.1| WP_004217753.1.14456 WP_004217753.1.16162 WP_004217753.1.20477 WP_004217753.1.21588 WP_004217753.1.22654 WP_004217753.1.23267 WP_004217753.1.23846 WP_004217753.1.23969 WP_004217753.1.26294 WP_004217753.1.38287 WP_004217753.1.38998 WP_004217753.1.45260 WP_004217753.1.45775 WP_004217753.1.47471 WP_004217753.1.47549 WP_004217753.1.50484 WP_004217753.1.53490 WP_004217753.1.62237 WP_004217753.1.66072 WP_004217753.1.75174 WP_004217753.1.78909 WP_004217753.1.86686 WP_004217753.1.86797 WP_004217753.1.94304 gi|384195568|ref|YP_005581313.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]